BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f07 (601 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF040646-2|AAK31538.1| 275|Caenorhabditis elegans Hypothetical ... 29 2.5 U50197-2|AAA91255.2| 624|Caenorhabditis elegans Hypothetical pr... 29 3.3 Z82274-12|CAJ76931.1| 304|Caenorhabditis elegans Hypothetical p... 28 5.9 Z82274-11|CAB54268.2| 315|Caenorhabditis elegans Hypothetical p... 28 5.9 AF324487-1|AAK49908.1| 315|Caenorhabditis elegans JC8.12-like p... 28 5.9 >AF040646-2|AAK31538.1| 275|Caenorhabditis elegans Hypothetical protein H17B01.3 protein. Length = 275 Score = 29.1 bits (62), Expect = 2.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 306 AVIFPMGFHVDEIGGQPYQLPNSHQV 383 ++ F +G +E G PY++P +HQV Sbjct: 224 SIQFGLGIARNECGSDPYEIPGAHQV 249 >U50197-2|AAA91255.2| 624|Caenorhabditis elegans Hypothetical protein F25E2.2 protein. Length = 624 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 473 LKVWETHFPSKKFRYHCYPKGENK*Y 396 L+ WETH K F+YHC G N Y Sbjct: 66 LQQWETH-NEKWFKYHCVIDGTNAQY 90 >Z82274-12|CAJ76931.1| 304|Caenorhabditis elegans Hypothetical protein JC8.12b protein. Length = 304 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 354 PYQLPNSHQVGISYILFVLSLWITVISELFAGKVCLPHF 470 PY + I IL+ +S WITV S F G + +P+F Sbjct: 55 PYCFEKGRHIVIPSILYTISQWITVAS--FEG-IAMPNF 90 >Z82274-11|CAB54268.2| 315|Caenorhabditis elegans Hypothetical protein JC8.12a protein. Length = 315 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 354 PYQLPNSHQVGISYILFVLSLWITVISELFAGKVCLPHF 470 PY + I IL+ +S WITV S F G + +P+F Sbjct: 66 PYCFEKGRHIVIPSILYTISQWITVAS--FEG-IAMPNF 101 >AF324487-1|AAK49908.1| 315|Caenorhabditis elegans JC8.12-like protein protein. Length = 315 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 354 PYQLPNSHQVGISYILFVLSLWITVISELFAGKVCLPHF 470 PY + I IL+ +S WITV S F G + +P+F Sbjct: 66 PYCFEKGRHIVIPSILYTISQWITVAS--FEG-IAMPNF 101 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,840,925 Number of Sequences: 27780 Number of extensions: 296167 Number of successful extensions: 617 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 617 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -