BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f05 (625 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 4.8 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.4 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.8 bits (44), Expect = 4.8 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 211 TFVTYRKWTQH 243 TF YR W QH Sbjct: 489 TFYDYRPWVQH 499 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 8.4 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 497 IKRFSVWLNSLDVYRLSASKVHNYVQTGSRMQVGLDMDTFVHLDQPPR 354 I R S +++L + + ++ V NY S T + ++ PPR Sbjct: 653 INRASKRVSTLSIDNVQSTHVGNYTCLASNSASVTTYTTSLFINVPPR 700 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,012 Number of Sequences: 336 Number of extensions: 3421 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -