BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f05 (625 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0867 - 20414999-20415160,20415255-20415384,20415515-204157... 31 0.56 05_07_0228 - 28526885-28527046,28527151-28527241,28528315-285284... 28 5.2 03_03_0254 + 15884149-15884295,15884765-15884803,15884958-158851... 28 5.2 12_02_0326 + 17555731-17556387 28 6.9 08_02_0274 - 15192670-15192983,15193110-15193200,15193295-151936... 27 9.2 >04_03_0867 - 20414999-20415160,20415255-20415384,20415515-20415702, 20415967-20416001,20416363-20416579,20416737-20416820, 20417609-20417875,20417954-20418061,20418163-20418249, 20418629-20419399 Length = 682 Score = 31.5 bits (68), Expect = 0.56 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +3 Query: 237 PTQIQTLCQRTGKQVATS*PLTTFWIHGTIT-FWMIVNSFARRLVEMNKRIHIQTHLHTA 413 PT +Q + G Q+ T PL + I W+++ S RRL +++K HI + T Sbjct: 261 PTSLQLIAM--GHQMVTINPLLSVVAATVIPCMWLVIASLGRRLRQISKEAHISLAMLTV 318 Query: 414 TRLDII 431 D++ Sbjct: 319 YLNDVL 324 >05_07_0228 - 28526885-28527046,28527151-28527241,28528315-28528455, 28528560-28528625,28529180-28529317,28529759-28529860, 28530156-28530236,28530314-28530383,28530598-28530674, 28531035-28531483 Length = 458 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 Query: 434 GPSKPTAYTHPANSATPKISLLKPDLTELVRPVTSKVISKVNGLLG 571 G P+ THP N+ATP S + +VRP S V+G G Sbjct: 37 GLHAPSISTHPTNAATPNPSPPGASIVVVVRPAMQPA-SPVSGDAG 81 >03_03_0254 + 15884149-15884295,15884765-15884803,15884958-15885136, 15887175-15887310,15887769-15887865,15888448-15888534, 15888621-15888721,15888905-15888939,15889520-15889577, 15889650-15889724,15890048-15890135,15890155-15890308, 15890395-15890638 Length = 479 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 128 IQGRTSNTFPVMAQFPTYRNFIPKETNQPLLHI 226 I R SN M Q TY+N++ KET+ LLH+ Sbjct: 260 INQRVSNA--AMDQGITYQNYLSKETSDLLLHL 290 >12_02_0326 + 17555731-17556387 Length = 218 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 357 RRLVEMNKRIHIQTHLHTATRLDIIMDLRSRQPIHIQRIQP 479 R V ++ I + +HL R+ I RSR+P+H+Q P Sbjct: 39 RPSVRLSGSIPLPSHLPHPRRIPITPASRSRKPLHLQPHHP 79 >08_02_0274 - 15192670-15192983,15193110-15193200,15193295-15193603, 15193859-15193944,15196034-15196088,15196689-15196757, 15197027-15197074,15198090-15198203,15198464-15198526, 15199236-15199427,15199519-15199643,15199723-15199779, 15200209-15200332,15200478-15200543,15200656-15200738, 15200916-15201036,15201663-15201773,15201841-15201936, 15202032-15202107,15202878-15203016,15203283-15203346, 15203454-15203527,15203845-15203923,15204473-15204547 Length = 876 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 64 VSKTDRLRDRRSISSEYGLSADTGANFEHFPGHGSVSD 177 ++K RL+ +R + + AD G ++ H P HG + D Sbjct: 299 LAKEARLKIKR-VDPTLDMEADAGDDYIHLPDHGIIRD 335 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,091,312 Number of Sequences: 37544 Number of extensions: 349286 Number of successful extensions: 940 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -