BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f05 (625 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U09410-1|AAC50251.1| 475|Homo sapiens zinc finger protein ZNF13... 30 7.6 BC035875-1|AAH35875.1| 510|Homo sapiens ZNF131 protein protein. 30 7.6 >U09410-1|AAC50251.1| 475|Homo sapiens zinc finger protein ZNF131 protein. Length = 475 Score = 29.9 bits (64), Expect = 7.6 Identities = 21/80 (26%), Positives = 33/80 (41%), Gaps = 5/80 (6%) Frame = -3 Query: 491 RFSVWLNSLDVYRLSASKVHNYVQTGSRMQV----GLDMDTFVHLDQPPRETVHDHPESD 324 R S W L+ Y L V +TG ++ V D F H + R+ + P Sbjct: 151 RESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFGHFKEHLRKHTGEKPFEC 210 Query: 323 RPMYPK-SRQRSARCHLFAC 267 + + +R + +CHL AC Sbjct: 211 PNCHERFARNSTLKCHLTAC 230 >BC035875-1|AAH35875.1| 510|Homo sapiens ZNF131 protein protein. Length = 510 Score = 29.9 bits (64), Expect = 7.6 Identities = 21/80 (26%), Positives = 33/80 (41%), Gaps = 5/80 (6%) Frame = -3 Query: 491 RFSVWLNSLDVYRLSASKVHNYVQTGSRMQV----GLDMDTFVHLDQPPRETVHDHPESD 324 R S W L+ Y L V +TG ++ V D F H + R+ + P Sbjct: 186 RESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFGHFKEHLRKHTGEKPFEC 245 Query: 323 RPMYPK-SRQRSARCHLFAC 267 + + +R + +CHL AC Sbjct: 246 PNCHERFARNSTLKCHLTAC 265 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,334,859 Number of Sequences: 237096 Number of extensions: 2061992 Number of successful extensions: 8601 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8601 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6747805200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -