BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f03 (443 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73098-8|CAA97334.2| 303|Caenorhabditis elegans Hypothetical pr... 28 2.7 Z78012-8|CAB01418.2| 945|Caenorhabditis elegans Hypothetical pr... 28 3.5 Z75953-6|CAB00103.2| 945|Caenorhabditis elegans Hypothetical pr... 28 3.5 AY275181-1|AAP32289.1| 945|Caenorhabditis elegans soluble guany... 28 3.5 U29096-2|AAX88830.1| 133|Caenorhabditis elegans Hypothetical pr... 27 8.1 >Z73098-8|CAA97334.2| 303|Caenorhabditis elegans Hypothetical protein T21C9.7 protein. Length = 303 Score = 28.3 bits (60), Expect = 2.7 Identities = 11/51 (21%), Positives = 27/51 (52%) Frame = -1 Query: 299 YPTLRTETHYCFTAEIGGVVVPTRADSQEVLPPVITQIIILRVWFLLHDVI 147 +P ++ ++ +GG T A+S EVL ++T +I+ ++ +++ Sbjct: 148 WPIATNNAYFIYSPTLGGFATKTVANSTEVLNSLVTFMIVFTLFTATANIV 198 >Z78012-8|CAB01418.2| 945|Caenorhabditis elegans Hypothetical protein F57F5.2 protein. Length = 945 Score = 27.9 bits (59), Expect = 3.5 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 317 QYSYNGYPTLRTETHYCFTAEIGGVVVPTRADSQEVLPPVITQII-ILRVWFLL 159 +Y YP LR + YC + G+++ R+ L VI Q++ + RV++ L Sbjct: 105 EYFRFSYPKLRAPSFYCKSESEDGLILHYRSRRTGYLSYVIGQLVELARVFYQL 158 >Z75953-6|CAB00103.2| 945|Caenorhabditis elegans Hypothetical protein F57F5.2 protein. Length = 945 Score = 27.9 bits (59), Expect = 3.5 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 317 QYSYNGYPTLRTETHYCFTAEIGGVVVPTRADSQEVLPPVITQII-ILRVWFLL 159 +Y YP LR + YC + G+++ R+ L VI Q++ + RV++ L Sbjct: 105 EYFRFSYPKLRAPSFYCKSESEDGLILHYRSRRTGYLSYVIGQLVELARVFYQL 158 >AY275181-1|AAP32289.1| 945|Caenorhabditis elegans soluble guanylyl cyclase GCY-33 protein. Length = 945 Score = 27.9 bits (59), Expect = 3.5 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 317 QYSYNGYPTLRTETHYCFTAEIGGVVVPTRADSQEVLPPVITQII-ILRVWFLL 159 +Y YP LR + YC + G+++ R+ L VI Q++ + RV++ L Sbjct: 105 EYFRFSYPKLRAPSFYCKSESEDGLILHYRSRRTGYLSYVIGQLVELARVFYQL 158 >U29096-2|AAX88830.1| 133|Caenorhabditis elegans Hypothetical protein F30H5.5 protein. Length = 133 Score = 26.6 bits (56), Expect = 8.1 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 28 TSGAFVLKRCTG-VRIPQAGTNFSNEIRTQQMFTIDFHGEGI 150 TS A +L+ ++ Q T NE T+Q+FT+D++ I Sbjct: 23 TSDAEILEITNAHIKAIQVATRSMNETATRQLFTLDYNNPKI 64 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,984,769 Number of Sequences: 27780 Number of extensions: 228890 Number of successful extensions: 463 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 767282256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -