BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12e22 (493 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y09723-1|CAA70889.1| 803|Homo sapiens Miz-1 protein protein. 31 1.6 BC126163-1|AAI26164.1| 803|Homo sapiens zinc finger and BTB dom... 31 1.6 AL034555-3|CAB85445.1| 803|Homo sapiens zinc finger and BTB dom... 31 1.6 AL034555-2|CAI19525.1| 240|Homo sapiens zinc finger and BTB dom... 31 1.6 AK223618-1|BAD97338.1| 803|Homo sapiens zinc finger and BTB dom... 31 1.6 BC033985-1|AAH33985.1| 165|Homo sapiens hypothetical gene suppo... 30 3.8 D87443-1|BAA13384.2| 1009|Homo sapiens KIAA0254 protein. 30 5.0 BC031620-1|AAH31620.1| 803|Homo sapiens SNX19 protein protein. 30 5.0 AF395843-1|AAK73124.1| 992|Homo sapiens SNX19 protein. 30 5.0 AF293341-1|AAK35009.1| 642|Homo sapiens collagen-like Alzheimer... 29 8.8 AC097473-2|AAY40947.1| 317|Homo sapiens unknown protein. 29 8.8 >Y09723-1|CAA70889.1| 803|Homo sapiens Miz-1 protein protein. Length = 803 Score = 31.5 bits (68), Expect = 1.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 219 EKTLADKGTMQRHLRCALGEGPCDMV 296 ++ AD G +QRH+R GE PC V Sbjct: 508 QRQFADPGALQRHVRIHTGEKPCQCV 533 >BC126163-1|AAI26164.1| 803|Homo sapiens zinc finger and BTB domain containing 17 protein. Length = 803 Score = 31.5 bits (68), Expect = 1.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 219 EKTLADKGTMQRHLRCALGEGPCDMV 296 ++ AD G +QRH+R GE PC V Sbjct: 508 QRQFADPGALQRHVRIHTGEKPCQCV 533 >AL034555-3|CAB85445.1| 803|Homo sapiens zinc finger and BTB domain containing 17 protein. Length = 803 Score = 31.5 bits (68), Expect = 1.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 219 EKTLADKGTMQRHLRCALGEGPCDMV 296 ++ AD G +QRH+R GE PC V Sbjct: 508 QRQFADPGALQRHVRIHTGEKPCQCV 533 >AL034555-2|CAI19525.1| 240|Homo sapiens zinc finger and BTB domain containing 17 protein. Length = 240 Score = 31.5 bits (68), Expect = 1.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 219 EKTLADKGTMQRHLRCALGEGPCDMV 296 ++ AD G +QRH+R GE PC V Sbjct: 64 QRQFADPGALQRHVRIHTGEKPCQCV 89 >AK223618-1|BAD97338.1| 803|Homo sapiens zinc finger and BTB domain containing 17 variant protein. Length = 803 Score = 31.5 bits (68), Expect = 1.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 219 EKTLADKGTMQRHLRCALGEGPCDMV 296 ++ AD G +QRH+R GE PC V Sbjct: 508 QRQFADPGALQRHVRIHTGEKPCQCV 533 >BC033985-1|AAH33985.1| 165|Homo sapiens hypothetical gene supported by BC033985 protein. Length = 165 Score = 30.3 bits (65), Expect = 3.8 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 258 LRCALGEGPCDMVG-RRLRTLAPFVLRGACPQCSVQESR 371 L C+LG+ P + G RR T F R CP CS SR Sbjct: 86 LSCSLGQAPRQLYGRRRCTTHILFPGRACCPGCSECGSR 124 >D87443-1|BAA13384.2| 1009|Homo sapiens KIAA0254 protein. Length = 1009 Score = 29.9 bits (64), Expect = 5.0 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +3 Query: 306 LRTLAPFVLRGACPQCSVQESRHIRRTLAYIQRNYPWEWARIVRQ 440 L P CP+ Q R I RT+ I R++ W R V Q Sbjct: 96 LERFIPLATCPPCPEAERQLEREINRTIQMIIRDFVLSWYRSVSQ 140 >BC031620-1|AAH31620.1| 803|Homo sapiens SNX19 protein protein. Length = 803 Score = 29.9 bits (64), Expect = 5.0 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +3 Query: 306 LRTLAPFVLRGACPQCSVQESRHIRRTLAYIQRNYPWEWARIVRQ 440 L P CP+ Q R I RT+ I R++ W R V Q Sbjct: 79 LERFIPLATCPPCPEAERQLEREINRTIQMIIRDFVLSWYRSVSQ 123 >AF395843-1|AAK73124.1| 992|Homo sapiens SNX19 protein. Length = 992 Score = 29.9 bits (64), Expect = 5.0 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +3 Query: 306 LRTLAPFVLRGACPQCSVQESRHIRRTLAYIQRNYPWEWARIVRQ 440 L P CP+ Q R I RT+ I R++ W R V Q Sbjct: 79 LERFIPLATCPPCPEAERQLEREINRTIQMIIRDFVLSWYRSVSQ 123 >AF293341-1|AAK35009.1| 642|Homo sapiens collagen-like Alzheimer amyloid plaque component precursor type II protein. Length = 642 Score = 29.1 bits (62), Expect = 8.8 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 277 SPSAHLRCLCIVPLSARVFSNCAS 206 SPS H+ CL ++ LSA +FS C S Sbjct: 618 SPSQHVPCLILLLLSALLFSLCDS 641 >AC097473-2|AAY40947.1| 317|Homo sapiens unknown protein. Length = 317 Score = 29.1 bits (62), Expect = 8.8 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 277 SPSAHLRCLCIVPLSARVFSNCAS 206 SPS H+ CL ++ LSA +FS C S Sbjct: 293 SPSQHVPCLILLLLSALLFSLCDS 316 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,480,439 Number of Sequences: 237096 Number of extensions: 1628516 Number of successful extensions: 3034 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3034 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4423060356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -