BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12e18 (506 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g01380.1 68416.m00060 phosphatidylinositolglycan class N (PIG... 27 5.5 At5g13700.1 68418.m01595 polyamine oxidase, putative similar to ... 27 7.3 >At3g01380.1 68416.m00060 phosphatidylinositolglycan class N (PIG-N) family protein similar to phosphatidylinositolglycan class N short form GB:BAA82620 [gi:5631308] [Mus musculus] Length = 921 Score = 27.5 bits (58), Expect = 5.5 Identities = 12/50 (24%), Positives = 25/50 (50%) Frame = -1 Query: 494 LXMNELHRLPVIIIRIWLFIGKIIRLSTSNSRNSLFFISLDGIIYESNSI 345 + +NE + ++ + +++R S S NSLFF +++ S S+ Sbjct: 401 MKLNEAEEVEAVVANTKQILNQLLRKSYIKSSNSLFFKPFKPLVHHSFSL 450 >At5g13700.1 68418.m01595 polyamine oxidase, putative similar to SP|O64411 Polyamine oxidase precursor (EC 1.5.3.11) from Zea mays Length = 472 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -1 Query: 443 LFIGKIIRLSTSNSRNSLFFISLDGIIYESNSILLKSEYSYLQ 315 L + +++R SRN + + DG +YE+N +++ + LQ Sbjct: 207 LKLNQVVR-EVQQSRNGVVVKTEDGSVYEANYVIVSASIGVLQ 248 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,403,335 Number of Sequences: 28952 Number of extensions: 84195 Number of successful extensions: 191 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -