BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12e16 (563 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 27 0.42 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 27 0.42 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 1.7 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 3.0 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 5.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.9 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 9.1 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 27.1 bits (57), Expect = 0.42 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -1 Query: 188 HFVFKYYSILLCAQ*RFSWLTSHFAVSPLFSILSNL 81 HF+F+Y + + + +SW T + F+IL NL Sbjct: 27 HFLFRYVTGPILIRKVYSWWTLAMVLIQFFAILGNL 62 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 27.1 bits (57), Expect = 0.42 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -1 Query: 188 HFVFKYYSILLCAQ*RFSWLTSHFAVSPLFSILSNL 81 HF+F+Y + + + +SW T + F+IL NL Sbjct: 27 HFLFRYVTGPILIRKVYSWWTLAMVLIQFFAILGNL 62 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 25.0 bits (52), Expect = 1.7 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 477 RSHDLRG-LYLLVCDLSALADAPVSDLPVRLVNFADRAHWA 358 R H L G L LLVC L A+ PVS P + + +WA Sbjct: 14 RRHLLTGSLLLLVCLLLAIDPTPVSADPDEDIPHNEVRNWA 54 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 3.0 Identities = 19/59 (32%), Positives = 26/59 (44%) Frame = +3 Query: 345 RPSRRPNGRDQQSSQVGPEDRTPAXXXXXXDHIQEDTVLADHGIDTARHPARYRRPSVE 521 R S NG +QSS G A + +D ++ D AR +YRRP+VE Sbjct: 1178 RSSATNNGGGRQSSNNG----LGAGGRTNFAYQVDDDFDDNYSDDDAREEMQYRRPTVE 1232 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.4 bits (48), Expect = 5.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 398 GRSDTG-ASARAERSHTRRYSPRRSWDR 478 GR TG AER RR PRR DR Sbjct: 319 GRLRTGPVPGAAERHRRRRPPPRRRHDR 346 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 6.9 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = +3 Query: 342 LRPSRRPNGRDQQSSQVGPEDRTPAXXXXXXDHIQEDTVLADHG 473 L+P RP+ S V P D P D ++ D HG Sbjct: 1158 LQPKTRPSIMLPGPSAVEPSDEMPKSLRYCKDPLKPDDETDGHG 1201 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 22.6 bits (46), Expect = 9.1 Identities = 19/73 (26%), Positives = 30/73 (41%) Frame = +1 Query: 211 ASGDSDHIEVMESSVLKKSENATEQSVAEDDDRDRSSIAEKNVPYDPAVGPMGAISKVHK 390 A + + V + S L + +A+ S+ RS+ A + GA + Sbjct: 150 APASGEKVPVGQLSPLDLAFDASSGSLTSASQLKRSAEAAAIIASTAPSADGGAGHEAE- 208 Query: 391 SDRKIGHRRVGEG 429 D +GH RVGEG Sbjct: 209 -DTALGHGRVGEG 220 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,773 Number of Sequences: 2352 Number of extensions: 11533 Number of successful extensions: 29 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -