BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12e15 (528 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1685.08 |||histone deacetylase complex subunit Cti6|Schizosa... 27 2.3 SPAC56F8.10 |met9|met5|methylenetetrahydrofolate reductase Met9|... 25 5.3 SPBC30B4.07c |tfb4||transcription factor TFIIH complex subunit T... 25 5.3 >SPBC1685.08 |||histone deacetylase complex subunit Cti6|Schizosaccharomyces pombe|chr 2|||Manual Length = 424 Score = 26.6 bits (56), Expect = 2.3 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 371 YHKFYAIKMTPKKTMSPRRNLGKTGEKLKS*RRPEKLEQXQPLLMKQ 511 Y ++ AI +K++ PRR+ G+T K S P+ Q + +KQ Sbjct: 162 YEEYLAI--AKEKSLIPRRSRGRTSSKSLSPPAPQDESQGTEINLKQ 206 >SPAC56F8.10 |met9|met5|methylenetetrahydrofolate reductase Met9|Schizosaccharomyces pombe|chr 1|||Manual Length = 603 Score = 25.4 bits (53), Expect = 5.3 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +2 Query: 329 KILYRQWRRRLVYLYHKFYAIKMTPKKTMSPRRNLGKTGEKLKS*RRP 472 K+L+ W+ ++ Y Y F P KT + +NL +++K+ RP Sbjct: 6 KLLHPDWKEKVTYSYEFF------PPKTSTGVQNLYNRIDRMKTWGRP 47 >SPBC30B4.07c |tfb4||transcription factor TFIIH complex subunit Tfb4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 297 Score = 25.4 bits (53), Expect = 5.3 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 146 KIDTSNNLCLQFLMLK*FKNKKDRKDIVSCEPKN*CFRL*LFYHK 280 K+D L LQ+LM+ F ++ RK + + N FR F HK Sbjct: 213 KVDNPKGL-LQYLMMSLFPDQNLRKHLNTPNQANVDFRATCFCHK 256 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,764,517 Number of Sequences: 5004 Number of extensions: 29853 Number of successful extensions: 59 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 216376042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -