BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12e13 (639 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1HPN0 Cluster: Insulin-related peptide binding protein... 156 5e-37 UniRef50_A7QPK0 Cluster: Chromosome chr18 scaffold_137, whole ge... 35 1.4 UniRef50_UPI00006CBA26 Cluster: EB1 protein; n=1; Tetrahymena th... 35 1.9 UniRef50_Q6CM71 Cluster: Similar to sp|P47108 Saccharomyces cere... 33 4.4 >UniRef50_Q1HPN0 Cluster: Insulin-related peptide binding protein; n=1; Bombyx mori|Rep: Insulin-related peptide binding protein - Bombyx mori (Silk moth) Length = 255 Score = 156 bits (378), Expect = 5e-37 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 419 MHLVLLFTVAALLGSCQSAHLNKHIKLLSDIDNSIENGVQAKSDGSHKYLSITQGPLPSY 598 MHLVLLFTVAALLGSCQSAHLNKHIKLLSDIDNSIENGVQAKSDGSHKYLSITQGPLPSY Sbjct: 1 MHLVLLFTVAALLGSCQSAHLNKHIKLLSDIDNSIENGVQAKSDGSHKYLSITQGPLPSY 60 Query: 599 AHTPGTTIELTCE 637 AHTPGTTIELTCE Sbjct: 61 AHTPGTTIELTCE 73 >UniRef50_A7QPK0 Cluster: Chromosome chr18 scaffold_137, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr18 scaffold_137, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 1238 Score = 35.1 bits (77), Expect = 1.4 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +2 Query: 416 RMHLVLLFTVAALLGSCQSAHLNKHIKLLSDIDNSIENGVQAKSDGS-HKYLSITQGPLP 592 RM +VLL V + Q +++N H +L D + + NG Q S H YL+ P P Sbjct: 50 RMRMVLLLLVWISVAQAQQSYVNNH-QLDCDNNFNETNGFQCNGPRSCHSYLTFRSAP-P 107 Query: 593 SYAHTPGTTIELTCE 637 SY P L E Sbjct: 108 SYDSPPSIAYLLNSE 122 >UniRef50_UPI00006CBA26 Cluster: EB1 protein; n=1; Tetrahymena thermophila SB210|Rep: EB1 protein - Tetrahymena thermophila SB210 Length = 554 Score = 34.7 bits (76), Expect = 1.9 Identities = 18/73 (24%), Positives = 36/73 (49%) Frame = -1 Query: 354 DEISAATIFTVNILRRYVKKLLYRTTRRIYH**NTVHIILFVTNLNGGQLHAFQKLEHKF 175 D IS T+N +++Y+K +LY T +I + + L LN ++ F+ +E Sbjct: 314 DNISDKNPMTINDIKKYIKTILYSTQDQILTILDDGTVTLADKQLNNVSINQFESMEGLE 373 Query: 174 EIRMHVCDPDRSI 136 +++ + D+ I Sbjct: 374 QLKKEILSTDQQI 386 >UniRef50_Q6CM71 Cluster: Similar to sp|P47108 Saccharomyces cerevisiae YJR041c singleton; n=1; Kluyveromyces lactis|Rep: Similar to sp|P47108 Saccharomyces cerevisiae YJR041c singleton - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 1144 Score = 33.5 bits (73), Expect = 4.4 Identities = 20/51 (39%), Positives = 27/51 (52%) Frame = +2 Query: 425 LVLLFTVAALLGSCQSAHLNKHIKLLSDIDNSIENGVQAKSDGSHKYLSIT 577 LVLLFT G C +A L +K+L DID +I + A + K +S T Sbjct: 249 LVLLFTKCITTGKCDAATLETILKMLLDIDVTICADLLATLNAYRKIISQT 299 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 603,788,573 Number of Sequences: 1657284 Number of extensions: 11580137 Number of successful extensions: 26015 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 25274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26011 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 47711253245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -