BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12e12 (636 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42660| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_30356| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_58013| Best HMM Match : ABC_membrane (HMM E-Value=6.3e-28) 28 7.3 >SB_42660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 33.1 bits (72), Expect = 0.19 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +3 Query: 246 SPCCVPLDTCSHCLTIQCRHSTKRYSRTLRLQRCGYIKEFQH 371 SP C+P CSH + + H T ++ LR++ CG+ + +++ Sbjct: 53 SPSCIPDSLCSHSAS-RASHQTHSHTPYLRMRCCGWSRVYRN 93 >SB_30356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +2 Query: 284 FNNPVSAFYKA-LLANAATSALRLHQRIPAREISLSRDFMARFFLEDSAHYLFYSLIF 454 F +P AFY LL A R+ R+P LSR A + DS + S+ F Sbjct: 299 FTDPTKAFYVTQLLKGYAKQGARVDTRLPITLAILSRILSAANIITDSPYEAMCSVAF 356 >SB_58013| Best HMM Match : ABC_membrane (HMM E-Value=6.3e-28) Length = 951 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 425 RCPPGRTSP*NPARGRSLVLEFFDVAAALKSQRSRVTLC 309 RCPPGR P P + + LV FD+ +K + S + +C Sbjct: 85 RCPPGRGGPILPVKTK-LVPSLFDIDLEVK-KGSLIGIC 121 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,839,326 Number of Sequences: 59808 Number of extensions: 405093 Number of successful extensions: 1112 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1103 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -