BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12e09 (518 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ084201-1|AAY86708.1| 640|Homo sapiens netrin-G1 ligand splice... 30 5.6 BC041374-1|AAH41374.3| 640|Homo sapiens LRRC4C protein protein. 30 5.6 AY358293-1|AAQ88660.1| 640|Homo sapiens LNKM292 protein. 30 5.6 AB046800-1|BAB13406.1| 640|Homo sapiens KIAA1580 protein protein. 30 5.6 AM183303-1|CAJ66088.1| 418|Homo sapiens autogenous vein graft r... 29 7.4 >DQ084201-1|AAY86708.1| 640|Homo sapiens netrin-G1 ligand splice variant 3 protein. Length = 640 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 284 LKQIKTFGLCNVQICSVVCFCKSSIFKIISVR*RLTQV 171 L+ + GL Q C VC C + K+I VR L +V Sbjct: 33 LQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREV 70 >BC041374-1|AAH41374.3| 640|Homo sapiens LRRC4C protein protein. Length = 640 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 284 LKQIKTFGLCNVQICSVVCFCKSSIFKIISVR*RLTQV 171 L+ + GL Q C VC C + K+I VR L +V Sbjct: 33 LQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREV 70 >AY358293-1|AAQ88660.1| 640|Homo sapiens LNKM292 protein. Length = 640 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 284 LKQIKTFGLCNVQICSVVCFCKSSIFKIISVR*RLTQV 171 L+ + GL Q C VC C + K+I VR L +V Sbjct: 33 LQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREV 70 >AB046800-1|BAB13406.1| 640|Homo sapiens KIAA1580 protein protein. Length = 640 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 284 LKQIKTFGLCNVQICSVVCFCKSSIFKIISVR*RLTQV 171 L+ + GL Q C VC C + K+I VR L +V Sbjct: 33 LQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREV 70 >AM183303-1|CAJ66088.1| 418|Homo sapiens autogenous vein graft remodeling associated protein 2 protein. Length = 418 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = -1 Query: 374 YKYIINANISLYH*NDCVKVQITPEICINFLKQIKTFGLCNVQICSVVCFC 222 Y+ + N ++ +CV + ++ +C+ ++ + T LC VVC C Sbjct: 308 YRCMTNTHVYTQMHLECVCMYVSESVCVKSVECVCTESLCLCVCACVVCVC 358 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,929,756 Number of Sequences: 237096 Number of extensions: 1172471 Number of successful extensions: 5806 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5805 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -