BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12e08 (624 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1851.04c ||SPAC27D7.01c|guanyl-nucleotide exchange factor |S... 27 1.7 SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosa... 27 2.9 SPAC2C4.14c |ppk11||PAK-related kinase Ppk11|Schizosaccharomyces... 26 3.8 SPBC31F10.14c |hip3|hir3|HIRA interacting protein Hip3|Schizosac... 26 5.1 SPBC1734.06 |rhp18||Rad18 homolog Rhp18|Schizosaccharomyces pomb... 25 6.7 SPAC23G3.10c |ssr3||SWI/SNF and RSC complex subunit Ssr3|Schizos... 25 6.7 SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Ma... 25 6.7 SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic... 25 8.9 SPAC56F8.05c |mug64||conserved fungal protein|Schizosaccharomyce... 25 8.9 >SPAC1851.04c ||SPAC27D7.01c|guanyl-nucleotide exchange factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 1052 Score = 27.5 bits (58), Expect = 1.7 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 80 SKLHQTQNPFEISDKPSKIIGEEENGISAEITERD 184 SK+ ++QN FE K KI E GI A TE++ Sbjct: 49 SKITKSQNLFERHGKNKKIAVNSEYGIIAVATEKN 83 >SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 738 Score = 26.6 bits (56), Expect = 2.9 Identities = 20/77 (25%), Positives = 37/77 (48%) Frame = +3 Query: 240 IIREDYMVEAMEIVEMYCDLILARFGLVTQMKELDEGLAEAISTLIWVAPRMHTDVQELK 419 I+R DY V + C++I A+F ++K + A+ + I + Q LK Sbjct: 468 ILRNDYYVYLSHNLLTVCNIIKAQF---QRLKNANSIPAKQVENYITLVNSASLSKQYLK 524 Query: 420 IISDLLTAKYGKVYADA 470 I D ++++ +V+A A Sbjct: 525 SIVDGVSSRLEEVFAFA 541 >SPAC2C4.14c |ppk11||PAK-related kinase Ppk11|Schizosaccharomyces pombe|chr 1|||Manual Length = 312 Score = 26.2 bits (55), Expect = 3.8 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +3 Query: 261 VEAMEIVEMYCDLI-LARFGLVTQMKELDEGLAEAISTLIWVAPRM 395 ++A I+ M L+ LA FG+ Q++ L + + + T W+AP + Sbjct: 128 IKAANILTMKDGLVKLADFGVSGQLESLRDKNDDFVGTPFWMAPEV 173 >SPBC31F10.14c |hip3|hir3|HIRA interacting protein Hip3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1630 Score = 25.8 bits (54), Expect = 5.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 501 HLLCSHSRLYMHQHIPFHILQ*ASQILFLILVHLCAS 391 HL + Y H P++ L A Q L +IL+ LC+S Sbjct: 730 HLWYLLYQAYSSAHRPYNSLLCAFQSLKIILIRLCSS 766 >SPBC1734.06 |rhp18||Rad18 homolog Rhp18|Schizosaccharomyces pombe|chr 2|||Manual Length = 387 Score = 25.4 bits (53), Expect = 6.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 Query: 527 HRHFVLQFVTYCVHILASTCISIYL 453 H +F +T C H S CI YL Sbjct: 33 HEYFRAPLITSCSHTFCSFCIRDYL 57 >SPAC23G3.10c |ssr3||SWI/SNF and RSC complex subunit Ssr3|Schizosaccharomyces pombe|chr 1|||Manual Length = 425 Score = 25.4 bits (53), Expect = 6.7 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = -2 Query: 404 ICVHPRSYPYQSGYSFSKTFIEFLHLSDKTKPS*YQVTVHFYYFHSL 264 I ++P +P + Y SK F L + + T+P + FH L Sbjct: 195 IMLYPEEHPER--YKLSKAFANILGIREGTRPDIVSYLWQYIKFHRL 239 >SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 629 Score = 25.4 bits (53), Expect = 6.7 Identities = 12/44 (27%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = -2 Query: 536 WTVHRHFVLQFVTYCVHILASTCISI-YLSIF---CSEQVRYYF 417 W +F+ F +C IL +TCI + ++++ CSE +++ Sbjct: 513 WFHPLYFMFGFSFFCFGILVTTCIMVSIITVYFQLCSENYNWWW 556 >SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic subunit Bgs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1729 Score = 25.0 bits (52), Expect = 8.9 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Frame = -2 Query: 413 FLYICVHPRSYP---YQSGYSFSKTFIEFL 333 FL++CV + Y G+SFSKT + F+ Sbjct: 1525 FLFVCVDVVVFEVLGYLEGWSFSKTLLGFV 1554 >SPAC56F8.05c |mug64||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 295 Score = 25.0 bits (52), Expect = 8.9 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 168 KSRKEIAEYIASGKSERAKIRVEHIIREDYMVEAMEIV 281 KS AE +G E AKI E I+ +DY + + + Sbjct: 238 KSAVRSAEDELNGAIEHAKILYEQILNKDYNTDLLRSI 275 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,463,665 Number of Sequences: 5004 Number of extensions: 48608 Number of successful extensions: 160 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -