BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12e06 (559 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 5.1 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 5.1 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 6.8 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 6.8 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 9.0 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.4 bits (48), Expect = 5.1 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 400 PSRNRYCINS 371 P+R RYCINS Sbjct: 11 PTRKRYCINS 20 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 5.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 213 YSNWSNVFIKEQTRHARNPRNSFGTVSMDII 121 Y N ++ +K + A +P N G +S DI+ Sbjct: 1183 YHNINDPIVKLRATDADDPTNGNGQLSFDIV 1213 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -1 Query: 442 NTSTLHFSYYTCWQPSRNRYCINSF 368 N +T + TC +P YCI F Sbjct: 392 NVATANHPNATCGRPEFGDYCITDF 416 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 23.0 bits (47), Expect = 6.8 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = -3 Query: 140 PFLWTLYCTVCIENKLNNK 84 PF+ +C +C+ +LN++ Sbjct: 280 PFIIMAFCYICVSIRLNDR 298 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +2 Query: 305 IAVMNPEDSWVCKWQRISRFC 367 +++ NP +W W+ I R C Sbjct: 931 VSLENPSVNWRLLWRNIHRSC 951 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 585,983 Number of Sequences: 2352 Number of extensions: 12343 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -