BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12e05 (661 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0937 - 24568475-24569145,24569215-24569319,24569419-245699... 28 5.7 03_05_1157 + 30816143-30816359,30817005-30817120 28 5.7 >12_02_0937 - 24568475-24569145,24569215-24569319,24569419-24569991, 24570480-24570780,24570867-24572039,24572260-24572328 Length = 963 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 445 PDISPLLVKNKLVKHGWNEERSRDELLKYDPESND 549 P++ P V + +KH W+E ++ ELLK P D Sbjct: 736 PNVDPDDVSARGLKHVWSEIKAFQELLKQRPIQKD 770 >03_05_1157 + 30816143-30816359,30817005-30817120 Length = 110 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = +1 Query: 160 LRQYRFQRKPNESSGSGNQVTIKASTSSSQPQIIRMPAPNHTGQRQNNPVVV 315 +R Y R+P S+G+ + V + AS + S +TG + +P+++ Sbjct: 36 VRGYSILRRPANSTGTVDVVNVGASPNLSTSSAYAAAGIENTGNGEKSPLII 87 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,677,013 Number of Sequences: 37544 Number of extensions: 291870 Number of successful extensions: 694 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -