BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d21 (308 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY089416-1|AAL90154.1| 262|Drosophila melanogaster AT24031p pro... 26 8.2 AE013599-2757|AAF57646.3| 262|Drosophila melanogaster CG17821-P... 26 8.2 >AY089416-1|AAL90154.1| 262|Drosophila melanogaster AT24031p protein. Length = 262 Score = 26.2 bits (55), Expect = 8.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 95 YRYSTIEFLXSDFHDXSLDRLFSCFILFNKI 3 Y + + L SD D +DRL + F NK+ Sbjct: 87 YDFRCMTMLSSDHPDKDVDRLLTYFYFINKV 117 >AE013599-2757|AAF57646.3| 262|Drosophila melanogaster CG17821-PA protein. Length = 262 Score = 26.2 bits (55), Expect = 8.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 95 YRYSTIEFLXSDFHDXSLDRLFSCFILFNKI 3 Y + + L SD D +DRL + F NK+ Sbjct: 87 YDFRCMTMLSSDHPDKDVDRLLTYFYFINKV 117 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,973,133 Number of Sequences: 53049 Number of extensions: 76712 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 589756776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -