BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d20 (506 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41990-3|AAY44010.1| 291|Caenorhabditis elegans Hypothetical pr... 29 1.9 Z93239-1|CAB07528.1| 512|Caenorhabditis elegans Hypothetical pr... 28 4.5 >U41990-3|AAY44010.1| 291|Caenorhabditis elegans Hypothetical protein F52B10.2 protein. Length = 291 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -1 Query: 332 TPAYFHYKSAPER-KVFEISLPIVSVPRKP 246 +PAYFH K APER K + I+ V R P Sbjct: 92 SPAYFHSKMAPERIKSLNPNTKIIIVVRDP 121 >Z93239-1|CAB07528.1| 512|Caenorhabditis elegans Hypothetical protein H03A11.1 protein. Length = 512 Score = 27.9 bits (59), Expect = 4.5 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 140 RGAP*ILISVNVSS*LFEKLSKHFKMYFFISESAGRVFVAR 262 R P + +N+++ LFEK K K FF S + FV+R Sbjct: 232 RAIPTVGRVLNMTTELFEKAEKKLKKTFFFSPAKNFCFVSR 272 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,201,188 Number of Sequences: 27780 Number of extensions: 226516 Number of successful extensions: 527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -