BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d18 (569 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61940.1 68418.m07775 ubiquitin carboxyl-terminal hydrolase-r... 29 2.2 At5g38720.1 68418.m04683 expressed protein predicted protein, Dr... 28 3.8 At5g24880.1 68418.m02946 expressed protein ; expression supporte... 28 5.0 At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to... 27 6.7 At1g27040.2 68414.m03296 nitrate transporter, putative contains ... 27 6.7 At1g27040.1 68414.m03297 nitrate transporter, putative contains ... 27 6.7 At3g19890.1 68416.m02518 F-box family protein contains F-box dom... 27 8.8 At2g17550.1 68415.m02031 expressed protein 27 8.8 >At5g61940.1 68418.m07775 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1094 Score = 29.1 bits (62), Expect = 2.2 Identities = 22/54 (40%), Positives = 29/54 (53%) Frame = +1 Query: 334 SKATPSSKSRRPPTVLKSLTSGNSALRR*KL**QLRT*LAPESTRSSKRTLLRG 495 SK P SK RR + K TS +S+L + + + L PEST SS RT+ G Sbjct: 736 SKEKPQSKKRRDRSKKKPSTSISSSLDK-TVEHKPSVNLKPESTSSSLRTIEEG 788 >At5g38720.1 68418.m04683 expressed protein predicted protein, Drosophila melanogaster Length = 306 Score = 28.3 bits (60), Expect = 3.8 Identities = 16/53 (30%), Positives = 23/53 (43%) Frame = +3 Query: 150 VGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTEMKFKPGEEFEEDRADG 308 VG ++ N VEL +D L S+ K K + G+E + ADG Sbjct: 18 VGKKIQRKKNEKVSNVELSEDPQAAQLQAKSSEKPNRKKIQKGKEIKSSPADG 70 >At5g24880.1 68418.m02946 expressed protein ; expression supported by MPSS Length = 443 Score = 27.9 bits (59), Expect = 5.0 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 17 GAKNRRIKNLSLKSIKLIYKNGIRRQEIQDDFLREL**VHEDHRRGSDH 163 G++N RIK S K I L + Q+D E+ V DH + SDH Sbjct: 173 GSENVRIKKASDKEIAL---DSASMSSAQEDHQEEILKVESDHLQVSDH 218 >At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 585 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 102 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDG 215 K T +E ++ IGVGL+ A AV VE+++ G Sbjct: 414 KATKTETGVTHLQRIGVGLVLSILAMAVAALVEIKRKG 451 >At1g27040.2 68414.m03296 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 563 Score = 27.5 bits (58), Expect = 6.7 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 102 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRK 209 K+T SE ++ IGVGL+ A AV VEL++ Sbjct: 393 KVTKSEIGITHLQRIGVGLVLSIVAMAVAALVELKR 428 >At1g27040.1 68414.m03297 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 567 Score = 27.5 bits (58), Expect = 6.7 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 102 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRK 209 K+T SE ++ IGVGL+ A AV VEL++ Sbjct: 397 KVTKSEIGITHLQRIGVGLVLSIVAMAVAALVELKR 432 >At3g19890.1 68416.m02518 F-box family protein contains F-box domain Pfam:PF00646 Length = 410 Score = 27.1 bits (57), Expect = 8.8 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +3 Query: 195 VELRKDGDEYNLVTSSTFKTTEMKFKPGEEFEEDRADGAKV 317 VE+RKD LV SS++ + K EE EED+ K+ Sbjct: 354 VEVRKDVYRSALVCSSSYVPSLEKINQIEEEEEDKCKSIKM 394 >At2g17550.1 68415.m02031 expressed protein Length = 765 Score = 27.1 bits (57), Expect = 8.8 Identities = 16/85 (18%), Positives = 33/85 (38%) Frame = +3 Query: 111 SSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTEMKFKPGEEFE 290 + + F + + + G + + N R G ++ L + T T + +PG + Sbjct: 178 ADKRFKDCSRIVDSGCVVARDENKERLFTRTRSFGRDFTLKSDRTAPTRIVVLRPGLQRA 237 Query: 291 EDRADGAKVKSVCTFEGNTLKQVQK 365 D D S T EG+ +++ Sbjct: 238 YDYEDSLTTSSGTTMEGSRGSSIEE 262 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,731,165 Number of Sequences: 28952 Number of extensions: 239261 Number of successful extensions: 708 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -