BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d17 (538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3540| Best HMM Match : RF-1 (HMM E-Value=2.1) 31 0.79 SB_10066| Best HMM Match : GPS (HMM E-Value=8.6e-07) 27 9.7 >SB_3540| Best HMM Match : RF-1 (HMM E-Value=2.1) Length = 395 Score = 30.7 bits (66), Expect = 0.79 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 212 VMLTLILARAALLSHGGGCGLKSPMKQRLL 123 VM+T+ L+RA L+SH G L SP Q L Sbjct: 70 VMITMSLSRAFLVSHERGFSLSSPYVQEFL 99 >SB_10066| Best HMM Match : GPS (HMM E-Value=8.6e-07) Length = 1146 Score = 27.1 bits (57), Expect = 9.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 185 AALLSHGGGCGLKSPMKQRLLPTRVVDGRVIGEE 84 A S GG CG + + Q ++P D +V EE Sbjct: 375 ACQTSAGGSCGSATKVGQTIIPASTCDSKVTCEE 408 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,246,937 Number of Sequences: 59808 Number of extensions: 246937 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -