BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d17 (538 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 4.9 Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase pr... 23 6.5 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 23 8.6 AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. 23 8.6 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 23 8.6 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 4.9 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 316 RYFYVCTSLRTVVILKAELIARFIPD 393 RY Y C RT V + ++ FI + Sbjct: 1512 RYLYNCNGKRTTVFSEQGMVEEFITE 1537 >Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase protein. Length = 250 Score = 23.0 bits (47), Expect = 6.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 380 VSFLMIITFKVYLILYSEPVPL 445 ++ L+ IT V L+ SEPVPL Sbjct: 90 LNVLVFITNDVALLKLSEPVPL 111 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 22.6 bits (46), Expect = 8.6 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 79 CCSSPMTRPSTTRVGRRRCFIGDFRPQPPPW 171 CC +T +T R + F D+ P PW Sbjct: 14 CCVFALTIAATPRRFLQNRFTVDYEPFAGPW 44 >AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. Length = 94 Score = 22.6 bits (46), Expect = 8.6 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +3 Query: 399 LLLKFT*YYIQNPCLL*FHTTLKTPHKSPYELTSCQIVSDSKIAV 533 LLL T NP L ++ + PH P+++ S +V+ S+ A+ Sbjct: 17 LLLVSTEMTFANP--LSPNSPAERPHIQPFQMASAPLVAQSRSAM 59 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 22.6 bits (46), Expect = 8.6 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +1 Query: 82 CSSPMTRPSTTRVGRRRCFIGDFRPQPPPWESSAALARIS 201 C+ + S G + IGD +PP W + A A IS Sbjct: 190 CAFGLQCNSLKNGGSKLLEIGDKVFKPPAWRNMLAFALIS 229 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 482,443 Number of Sequences: 2352 Number of extensions: 8579 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -