BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d10 (394 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56738| Best HMM Match : Extensin_2 (HMM E-Value=0.076) 32 0.14 SB_50338| Best HMM Match : TNFR_c6 (HMM E-Value=1.4e-05) 31 0.25 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_3371| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_11794| Best HMM Match : TNFR_c6 (HMM E-Value=1.4e-05) 31 0.44 SB_28173| Best HMM Match : Sugar_tr (HMM E-Value=0.022) 29 1.0 SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_13966| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_11070| Best HMM Match : Sugar_tr (HMM E-Value=0.00011) 28 2.3 SB_896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_111| Best HMM Match : Drf_FH1 (HMM E-Value=0.31) 28 2.3 SB_37483| Best HMM Match : Drf_FH1 (HMM E-Value=6.6) 28 2.3 SB_3196| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 28 3.1 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 28 3.1 SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) 27 4.1 SB_50509| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_12991| Best HMM Match : TP2 (HMM E-Value=1.4) 27 4.1 SB_2629| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 27 5.4 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_55538| Best HMM Match : zf-BED (HMM E-Value=1.4) 27 7.2 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_55298| Best HMM Match : THAP (HMM E-Value=2.4e-11) 27 7.2 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_22151| Best HMM Match : MORN (HMM E-Value=6) 27 7.2 SB_11570| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_41099| Best HMM Match : VWA (HMM E-Value=0) 26 9.5 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.5 SB_29301| Best HMM Match : MFS_1 (HMM E-Value=2.9e-05) 26 9.5 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 26 9.5 SB_2570| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.5 SB_48269| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.5 >SB_56738| Best HMM Match : Extensin_2 (HMM E-Value=0.076) Length = 869 Score = 32.3 bits (70), Expect = 0.14 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = -1 Query: 325 VPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQ---KPIIKPIFI 155 VP + V PP +I F + P+ P L+ PP PP+ + KP+ K + + Sbjct: 315 VPGGMVVLPPPPMEAIDFTSSADVPSPIPPPLDFATPPMAPPVEFSDESSPKPLKKKL-V 373 Query: 154 LSKHEGPWL 128 ++ PWL Sbjct: 374 INSEAFPWL 382 >SB_50338| Best HMM Match : TNFR_c6 (HMM E-Value=1.4e-05) Length = 374 Score = 31.5 bits (68), Expect = 0.25 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -1 Query: 283 SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKPI 173 +I T C F L P LN+V P P A PT KP+ Sbjct: 133 NIVCSTTCKKGFQLHPNLNSVCIPIPTPTAKPTSKPM 169 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 31.1 bits (67), Expect = 0.33 Identities = 18/51 (35%), Positives = 21/51 (41%) Frame = -1 Query: 328 PVPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKP 176 P P+ PN PPP + +P P PY NPP PP P P Sbjct: 157 PPPLYPPPPNPPPP-NAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 30.3 bits (65), Expect = 0.58 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -1 Query: 304 PNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKP 176 P PPP + +P P APY NPP PPL P P Sbjct: 130 PPYPPPPNAPYPPS-----PNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 30.3 bits (65), Expect = 0.58 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 328 PVPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPP 200 P P PN PPP P + P P NA NPP PP Sbjct: 194 PYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 27.1 bits (57), Expect = 5.4 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = -1 Query: 304 PNVPPP*SITFPTECTNSFPL---APYLNAVNPPKRPPLAIPTQKPIIKP 164 P PPP + +P +P APY + N P PP P P+ P Sbjct: 114 PPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPP 163 Score = 27.1 bits (57), Expect = 5.4 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 304 PNVPPP*SITFPTECTNSFPLAPYLNAVN-PPKRPPLAIPTQKP 176 P PPP + +P +P P NA N PP PP P P Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPPP--NAPNPPPPNPPYPPPPNAP 218 Score = 26.2 bits (55), Expect = 9.5 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -1 Query: 304 PNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIP 188 P PPP + P +P P NA NPP PP P Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPP--NAPNPPYPPPPNAP 229 >SB_3371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1135 Score = 30.7 bits (66), Expect = 0.44 Identities = 32/103 (31%), Positives = 46/103 (44%), Gaps = 4/103 (3%) Frame = -1 Query: 328 PVPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNA--VNPPKRPPLAIPTQKPIIKPIFI 155 PVP + P PPP + PT C P +PYL A ++ + L ++ + +F Sbjct: 936 PVPHPLLRPCAPPPATALCPTPCYG--PYSPYLIAEYIHVAQGVHLPSHVKEVLTDGVFC 993 Query: 154 LSKHEGPWL**TAPGTGILNKTICKLF--LSFSYTKYNKITSK 32 L G TA L+K +LF L+ Y KY+K T K Sbjct: 994 LLDLCGDHE--TALLHATLSKGSRELFKTLNEEYNKYHKFTGK 1034 Score = 30.3 bits (65), Expect = 0.58 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -1 Query: 328 PVPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLA-IPTQKPIIKPI 161 PVP + P PPP + PT C P P L PP L P P+ P+ Sbjct: 886 PVPHPLLRPCAPPPATALCPTPCYGPVP-HPLLRPCAPPPATALCPTPCYGPVPHPL 941 Score = 29.9 bits (64), Expect = 0.77 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -1 Query: 328 PVPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLA-IPTQKPIIKPI 161 PVP + P PPP + PT C P P L PP L P P+ P+ Sbjct: 861 PVPHHLLRPCAPPPATALCPTPCYGPVP-HPLLRPCAPPPATALCPTPCYGPVPHPL 916 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/56 (28%), Positives = 20/56 (35%) Frame = -1 Query: 328 PVPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKPIIKPI 161 PVP + P PPP + PT C P PP P P+ P+ Sbjct: 836 PVPHPLLRPCAPPPATALCPTPCYGPVPHHLLRPCAPPPATALCPTPCYGPVPHPL 891 Score = 28.3 bits (60), Expect = 2.3 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = -1 Query: 328 PVPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPT 185 PVP + P PPP + PT C P P L PP L PT Sbjct: 911 PVPHPLLRPCAPPPATALCPTPCYGPVP-HPLLRPCAPPPATALC-PT 956 >SB_11794| Best HMM Match : TNFR_c6 (HMM E-Value=1.4e-05) Length = 331 Score = 30.7 bits (66), Expect = 0.44 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -1 Query: 283 SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKPI 173 +I T C F L P LN+V P P A PT KP+ Sbjct: 188 NIVCSTTCKMGFQLHPNLNSVCIPIPTPTANPTSKPM 224 >SB_28173| Best HMM Match : Sugar_tr (HMM E-Value=0.022) Length = 453 Score = 29.5 bits (63), Expect = 1.0 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 6/73 (8%) Frame = +3 Query: 180 FCVGMASGGLFGGFTALRYGARGKELVHSVGKVMLQGGGTFG------TFMAIGTGIRC* 341 F GM G + GG+ + R+G R LV S ++L G F F+ G G+ Sbjct: 122 FFAGMLVGSMVGGWASDRFGRRLCLLVGSAIMLILSFGTAFADCLSLLAFLRFGVGVAHV 181 Query: 342 LVF*CQ*VI*ISL 380 V CQ V I L Sbjct: 182 SVMVCQYVYVIEL 194 >SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 120 VYHNQGPSCFDKMKMGFMIGFCVGMASGGLFGGFTALRYGAR 245 VY SC++++ G + C +GG+ GG T + AR Sbjct: 1082 VYSVSLDSCYNELFTGRRLQSCGNQGTGGVIGGITRTIWSAR 1123 >SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 28.3 bits (60), Expect = 2.3 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 172 IKPIFILSKHEGPWL 128 IKP FI++KH+ PWL Sbjct: 100 IKPDFIVAKHDQPWL 114 >SB_13966| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 283 SITFPTECTNSFPLA-PYLNAVNPPKRPPLAIPTQKPIIKP 164 SI +PT T + P+ P A+ P P A+P PII P Sbjct: 194 SIIYPTALTITSPIIYPTALAITSPIIYPTALPITSPIIYP 234 Score = 27.9 bits (59), Expect = 3.1 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -1 Query: 280 ITFPTECTNSFPLA-PYLNAVNPPKRPPLAIPTQKPIIKP 164 I +PT + P+ P +NPP P A+P PII P Sbjct: 147 IIYPTALPITSPIIYPTALPINPPIIYPTALPITSPIIYP 186 >SB_11070| Best HMM Match : Sugar_tr (HMM E-Value=0.00011) Length = 468 Score = 28.3 bits (60), Expect = 2.3 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = +3 Query: 180 FCVGMASGGLFGGFTALRYGARGKELVHSVGKVMLQGGGTFGTFMA 317 F GM G L GG+ + R+G R LV S +L +FGTF A Sbjct: 121 FFAGMLIGSLVGGWASDRFGRRLCLLVGSAIMTIL----SFGTFFA 162 >SB_896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 968 Score = 28.3 bits (60), Expect = 2.3 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = +3 Query: 180 FCVGMASGGLFGGFTALRYGARGKELVHSVGKVMLQGGGTFGTFMA 317 F GM G L GG+ + R+G R LV S +L +FGTF A Sbjct: 634 FFAGMLIGSLVGGWASDRFGRRLCLLVGSAIMTIL----SFGTFFA 675 >SB_111| Best HMM Match : Drf_FH1 (HMM E-Value=0.31) Length = 241 Score = 28.3 bits (60), Expect = 2.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 203 RSFRRIYCIKVWSKGERVSTFRWKSNASRWRH 298 R+FRR+ C+ + E ++ F ++ +R RH Sbjct: 38 RAFRRVLCLSSQGESEPIAAFHARTGITRSRH 69 >SB_37483| Best HMM Match : Drf_FH1 (HMM E-Value=6.6) Length = 237 Score = 28.3 bits (60), Expect = 2.3 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 6/53 (11%) Frame = -1 Query: 340 QQRIPVPIAIKVPNVP-----PP*SITFPTECTNSFPLAP-YLNAVNPPKRPP 200 Q +P P+ + + P PP S PT +++P +P + PP+ PP Sbjct: 123 QPLVPTPVTLGGTSAPASTAAPPLSYPAPTSSPHAYPYSPAQVQLSTPPQTPP 175 >SB_3196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 28.3 bits (60), Expect = 2.3 Identities = 20/73 (27%), Positives = 24/73 (32%) Frame = -1 Query: 349 KTNQQRIPVPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKPII 170 + ++R P P V P T P VN RP A P +PI Sbjct: 66 EAGERRADAPRRQNTPVVDPTSGFTSVGADAEDGRYTPIDPLVNKDHRPQSAKPYGRPIT 125 Query: 169 KPIFILSKHEGPW 131 PI L PW Sbjct: 126 SPIPELRTQNAPW 138 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 27.9 bits (59), Expect = 3.1 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = -1 Query: 343 NQQRIPVPIA-IKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKP 176 ++ ++P+P ++ PPP I+ P T S P P A P PP P ++P Sbjct: 324 SRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 380 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 27.9 bits (59), Expect = 3.1 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = -1 Query: 343 NQQRIPVPIA-IKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKP 176 ++ ++P+P ++ PPP I+ P T S P P A P PP P ++P Sbjct: 236 SRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 292 >SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) Length = 1311 Score = 27.5 bits (58), Expect = 4.1 Identities = 21/67 (31%), Positives = 28/67 (41%) Frame = -1 Query: 331 IPVPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKPIIKPIFIL 152 +P P +P V P S T CT P P + A P KR P P KP+ + +I Sbjct: 1123 LPEPEVTPLPEVSPKSSETVAPTCTTESP--PDV-ASTPVKRYPRRTP--KPVSRKHYIW 1177 Query: 151 SKHEGPW 131 + W Sbjct: 1178 RREPDLW 1184 >SB_50509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 223 VNPPKRPPLAIPTQKPIIKP 164 V PP RPPLA Q P+ P Sbjct: 108 VTPPARPPLAAAQQPPLAVP 127 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 27.5 bits (58), Expect = 4.1 Identities = 19/56 (33%), Positives = 22/56 (39%) Frame = -1 Query: 304 PNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKPIIKPIFILSKHEG 137 P PPP S P P P L + PP PP T P + P + HEG Sbjct: 949 PTPPPPTSALPPPIPATQVPPPP-LPPLPPP--PPPVQTTTAPTLPPASCMPTHEG 1001 >SB_12991| Best HMM Match : TP2 (HMM E-Value=1.4) Length = 296 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 223 VNPPKRPPLAIPTQKPIIKP 164 V PP RPPLA Q P+ P Sbjct: 222 VTPPARPPLAAAQQPPLAYP 241 >SB_2629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 538 Score = 27.1 bits (57), Expect = 5.4 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = +3 Query: 123 YHNQGPSCFDKMKMGFMIGFCVGMASGGLFGGFTALRYGARGKELVH 263 YH PS FD FMI + G F GF +L+Y G + H Sbjct: 80 YHRGKPSPFDDRAPLFMISLILLPLLRGFFSGF-SLKYFCVGWAIKH 125 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 27.1 bits (57), Expect = 5.4 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = -1 Query: 328 PVPIAIKVPNVP--PP*SITFPTECTNSFPLAPYLN-AVNPPKRPPLAIPTQKPIIKPI 161 P P + P +P PP S T+ + ++ +N A PP PP A+ T P P+ Sbjct: 245 PPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPL 303 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 26.6 bits (56), Expect = 7.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 301 NVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKPIIKP 164 NVP P PTE P P PP PP PT P P Sbjct: 1014 NVPDPLPTDPPTEPPTDPPTPP---PTEPPTPPPTEPPTPPPTDPP 1056 >SB_55538| Best HMM Match : zf-BED (HMM E-Value=1.4) Length = 1108 Score = 26.6 bits (56), Expect = 7.2 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 331 IPVPIAIKVPNVPPP 287 IPVP+ + +P VPPP Sbjct: 904 IPVPVGMFIPPVPPP 918 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 26.6 bits (56), Expect = 7.2 Identities = 18/53 (33%), Positives = 21/53 (39%) Frame = -1 Query: 337 QRIPVPIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQK 179 Q +P+PI VP PPP P P P PP PP P Q+ Sbjct: 672 QILPIPIQTMVPPPPPPPPPPPPP------PPPPPPQPSTPPPPPPSTPPVQQ 718 >SB_55298| Best HMM Match : THAP (HMM E-Value=2.4e-11) Length = 273 Score = 26.6 bits (56), Expect = 7.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 254 LFPPCSIP*CSKSAEKTSTSHPYTK 180 ++ PC +P C A + HP+ K Sbjct: 1 MYSPCCVPYCRSRAAQAKNFHPFPK 25 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 26.6 bits (56), Expect = 7.2 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -1 Query: 322 PIAIKVPNVPPP*SITFPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKPIIKPIFILSKH 143 P VP PPP S T P P L P PP + PTQ P P S Sbjct: 99 PATTTVP-APPPSSTTAPVNAPAQ--QQPLLQPQRPT--PPSSYPTQPPSRHPTQTQSAI 153 Query: 142 EGP 134 GP Sbjct: 154 TGP 156 >SB_22151| Best HMM Match : MORN (HMM E-Value=6) Length = 186 Score = 26.6 bits (56), Expect = 7.2 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 Query: 194 G*WRSFRRIYCIKVWSKGERVSTFRWKSNASRWRHIWDFYGYWNW 328 G W R ++ WS GER S S +RW + + G W Sbjct: 89 GRWSGGERWSGVERWSGGERWSGVERWSGVARWSGVARWSGVARW 133 >SB_11570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 26.6 bits (56), Expect = 7.2 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 72 KNNLQIVLFKMPVPGAVYHNQGPSCFDKMKMGFMIGFCVGMAS 200 K +L + ++PV A YHN G DK F +G AS Sbjct: 328 KKDLSLAFRQIPVDPADYHNLGFQINDKFYFHTSFPFGLGTAS 370 >SB_41099| Best HMM Match : VWA (HMM E-Value=0) Length = 3373 Score = 26.2 bits (55), Expect = 9.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 214 PKRPPLAIPTQKPIIKP 164 P PP+ +PT++P+ KP Sbjct: 960 PTIPPVTVPTKRPVPKP 976 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 26.2 bits (55), Expect = 9.5 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -1 Query: 310 KVPNVPPP*SITFPTECTNSFPLAPYLNAVNPP--KRPPLAIPTQKPIIKPIF 158 + P PP ++T P+ + P+ P + PP +PP +IP +P+ P F Sbjct: 920 QAPPTLPPTTLTTPS-WSQPVPV-PSMYQPQPPGIMQPPTSIPPSQPMAPPSF 970 >SB_29301| Best HMM Match : MFS_1 (HMM E-Value=2.9e-05) Length = 662 Score = 26.2 bits (55), Expect = 9.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 186 VGMASGGLFGGFTALRYGAR 245 +GMA GG+ GG YGAR Sbjct: 554 LGMAIGGVLGGVLVHTYGAR 573 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 26.2 bits (55), Expect = 9.5 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = +3 Query: 165 GFMIGFCVGMASGGLFGGFTALRYGARGKELVHSVGKVMLQGGGTFGTFMAIGTG 329 G M+ G GG+ GG G G ++ + + GGG G M G G Sbjct: 168 GGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMG 222 >SB_2570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 26.2 bits (55), Expect = 9.5 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = +3 Query: 102 MPVPGAVYHNQGPSCFDKMKMGFMIGFCVGMASGGLFGGF 221 +P+ G +Y +G + D ++ + G+C + G + GF Sbjct: 158 LPIDGVLYMYKGANLQDLQRVRVIEGYCTNIHKGTIRVGF 197 >SB_48269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1720 Score = 26.2 bits (55), Expect = 9.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 251 RVSTFRWKSNASRWRHI 301 RVSTF K++ +WRH+ Sbjct: 1595 RVSTFHEKTSPQQWRHV 1611 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,521,151 Number of Sequences: 59808 Number of extensions: 251576 Number of successful extensions: 815 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 678472135 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -