BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d10 (394 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 2.3 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 22 7.0 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 22 7.0 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 22 7.0 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 22 7.0 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 2.3 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = -1 Query: 328 PVPIAIKVP-NVPPP*SIT----FPTECTNSFPLAPYLNAVNPPKRPPLAIPTQKPIIKP 164 P P ++ P NV PP + T P +P P + P+ PP A+P +P ++P Sbjct: 187 PGPQMMRPPGNVGPPRTGTPTQPQPPRPGGMYPQPPGVPMPMRPQMPPGAVPGMQPGMQP 246 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.2 bits (45), Expect = 7.0 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +3 Query: 195 ASGGLFGGFTALRYGARGKELVHSVGKVMLQGGGTFGTFMAIGTG 329 ASGG G +A + + + S GGT GT + G G Sbjct: 220 ASGGGGSGGSAGNFSSESNAQMDSTTNTTSNTGGTGGTGTSSGGG 264 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.2 bits (45), Expect = 7.0 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +3 Query: 195 ASGGLFGGFTALRYGARGKELVHSVGKVMLQGGGTFGTFMAIGTG 329 ASGG G +A + + + S GGT GT + G G Sbjct: 220 ASGGGGSGGSAGNFSSESNAQMDSTTNTTSNTGGTGGTGTSSGGG 264 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.2 bits (45), Expect = 7.0 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +3 Query: 195 ASGGLFGGFTALRYGARGKELVHSVGKVMLQGGGTFGTFMAIGTG 329 ASGG G +A + + + S GGT GT + G G Sbjct: 220 ASGGGGSGGSAGNFSSESNAQMDSTTNTTSNTGGTGGTGTSSGGG 264 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.2 bits (45), Expect = 7.0 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +3 Query: 195 ASGGLFGGFTALRYGARGKELVHSVGKVMLQGGGTFGTFMAIGTG 329 ASGG G +A + + + S GGT GT + G G Sbjct: 220 ASGGGGSGGSAGNFSSESNAQMDSTTNTTSNTGGTGGTGTSSGGG 264 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 400,687 Number of Sequences: 2352 Number of extensions: 8493 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30784536 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -