BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d09 (677 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.3 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 5.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.3 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 21 7.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.3 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 1.3 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 256 TTGRRLIDEICQIAAYTPKQTYSQ-YIMPYGDLNP 357 TT +LID+ C Y P ++ S Y+ G L P Sbjct: 1197 TTVSQLIDDKCDSGQYYPHESCSSFYVCVNGHLVP 1231 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +1 Query: 523 IYHEPRRFSPTMLLEALTRYD 585 +Y++PR SP + L +D Sbjct: 227 VYYDPRALSPNLEFVVLEAFD 247 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 454 EISALTDFLDWLEKEKGD 507 E T+ LD ++KEKGD Sbjct: 519 EADVKTEDLDEIQKEKGD 536 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 454 EISALTDFLDWLEKEKGD 507 E T+ LD ++KEKGD Sbjct: 519 EADVKTEDLDEIQKEKGD 536 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 454 EISALTDFLDWLEKEKGD 507 E T+ LD ++KEKGD Sbjct: 519 EADVKTEDLDEIQKEKGD 536 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 454 EISALTDFLDWLEKEKGD 507 E T+ LD ++KEKGD Sbjct: 519 EADVKTEDLDEIQKEKGD 536 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 676 RLTSLLPCIYL 644 RL L+PC+YL Sbjct: 27 RLEKLVPCVYL 37 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 229 TFLVGDRLASQPVREALQYSLPF 161 T LV RL ++PV +A PF Sbjct: 510 TSLVRGRLVAKPVADARDAPAPF 532 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,315 Number of Sequences: 336 Number of extensions: 3771 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -