BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d09 (677 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces ... 27 1.9 SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosacch... 27 2.5 SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 26 5.8 >SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces pombe|chr 3|||Manual Length = 1364 Score = 27.5 bits (58), Expect = 1.9 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -1 Query: 542 LLGSWYIRMTLPSPFSFSNQSRKSVKADISDFVLRIL*ETI 420 LL S+YI+ L + FS Q + A+ DFV +I ET+ Sbjct: 923 LLESFYIQFPLLELYKFSCQQLQDYIAEGKDFVTKIEEETL 963 >SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosaccharomyces pombe|chr 2|||Manual Length = 2352 Score = 27.1 bits (57), Expect = 2.5 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +1 Query: 274 IDEICQIAAYTPKQTYSQYIMPYGDLNPGARRRHNVRVVTVG 399 +D Q+ + + ++ + I DL P HNV+++T+G Sbjct: 1460 VDPSAQLLVFVGRWSHQKGIDLIADLAPKLLTEHNVQLITIG 1501 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 25.8 bits (54), Expect = 5.8 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -1 Query: 281 SSISLRPVVSMSQPIREYFPGGRPTGFSASAGGTSVFASISLPFTFTSVT 132 +S S+ P + + P+ P PT S T+ S S+P+T T VT Sbjct: 395 TSTSIPPTGNSTTPVTPTVP---PTSSSTPLTTTNCTTSTSVPYTSTPVT 441 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,810,037 Number of Sequences: 5004 Number of extensions: 56791 Number of successful extensions: 160 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -