BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d09 (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31903| Best HMM Match : Amino_oxidase (HMM E-Value=3.36312e-44) 29 3.5 SB_24638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_31903| Best HMM Match : Amino_oxidase (HMM E-Value=3.36312e-44) Length = 1021 Score = 29.1 bits (62), Expect = 3.5 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 5/79 (6%) Frame = +1 Query: 34 KTFVVHHTGLRGSYFVYQHLFINEFAN*ALMAMVTEVKV----NGSEMEANTEVPPALAE 201 K F++H + RG + V+Q++ IN LMA +T + N S+ + +EV L + Sbjct: 857 KEFILHASKRRGDFPVFQNVPINTKEGGVLMATITGSEALRIENQSDEDTRSEVMATLRQ 916 Query: 202 KPVGLP-PGKYSLIGWDMD 255 +P P + W D Sbjct: 917 LYGVIPEPTEMFYARWSKD 935 >SB_24638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 27.9 bits (59), Expect = 8.0 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 7/56 (12%) Frame = +1 Query: 388 VTVGRYRMLKDMVSHKILKTKSEI-----SALTDFLDWLEK--EKGDGSVILIYHE 534 V + Y + D V + LK K+ I ++++LDWLE+ EKGD ++ I E Sbjct: 29 VKIKPYEAVLDDVEKEGLKPKANIWIRDAVVISEYLDWLEREVEKGDNNLTEITGE 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,241,029 Number of Sequences: 59808 Number of extensions: 420514 Number of successful extensions: 1018 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1018 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -