BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12d04 (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10380.1 68414.m01169 expressed protein 28 4.8 At5g63770.1 68418.m08004 diacylglycerol kinase, putative similar... 27 8.4 >At1g10380.1 68414.m01169 expressed protein Length = 305 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 328 FVTYDCAEDDSPFFLEVASGSGQ 396 F DC+ D+SP F +++GSG+ Sbjct: 122 FTLLDCSVDESPVFTPLSNGSGR 144 >At5g63770.1 68418.m08004 diacylglycerol kinase, putative similar to diacylglycerol kinase, theta (diglyceride kinase, DGK- theta, DAG kinase theta). [Homo sapiens] SWISS-PROT:P52824 Length = 712 Score = 27.5 bits (58), Expect = 8.4 Identities = 18/61 (29%), Positives = 26/61 (42%) Frame = +1 Query: 292 RNQEPILQVLKRFVTYDCAEDDSPFFLEVASGSGQHLAHFAPHFPNIKFQPTEFDETLLG 471 RN+ L +K+F D D P + + + SG L F N+ P + E LG Sbjct: 319 RNKSAALNFMKKFSLVDLPPDARPLLVFINAKSGGQLGPFLHRRLNMLLNPVQVFE--LG 376 Query: 472 S 474 S Sbjct: 377 S 377 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,704,807 Number of Sequences: 28952 Number of extensions: 247695 Number of successful extensions: 529 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -