BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12c23 (514 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 29 0.092 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 0.65 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 26 0.65 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 0.86 AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 24 3.5 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 4.6 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 6.1 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 6.1 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 8.0 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 8.0 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 29.1 bits (62), Expect = 0.092 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +3 Query: 111 DGQEAEYPQHVCDRPRRSRQVNPHGLVGFQGRYHCWCESRR 233 D A QH+ RP+RS + NP GR H C+SRR Sbjct: 273 DENPAGAQQHLSHRPQRSTRKNP------AGRQHDRCDSRR 307 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 26.2 bits (55), Expect = 0.65 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 285 NGDATVLFVLTRVSETGLSGSRTSND 208 +GD T L +T ++E+G+ S TS D Sbjct: 194 SGDETDLDAITTLAESGIPSSNTSGD 219 Score = 25.0 bits (52), Expect = 1.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 209 SLLVREPERPVSLTRVRTNKTVASPLNLRPSLCSSSL 319 S L + PER SLT++ + + AS L S SS+L Sbjct: 666 SNLPKIPERKSSLTKLNRSNSTASNGTLERSYSSSTL 702 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 26.2 bits (55), Expect = 0.65 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 285 NGDATVLFVLTRVSETGLSGSRTSND 208 +GD T L +T ++E+G+ S TS D Sbjct: 195 SGDETDLDAITTLAESGIPSSNTSGD 220 Score = 25.0 bits (52), Expect = 1.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 209 SLLVREPERPVSLTRVRTNKTVASPLNLRPSLCSSSL 319 S L + PER SLT++ + + AS L S SS+L Sbjct: 667 SNLPKIPERKSSLTKLNRSNSTASNGTLERSYSSSTL 703 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.8 bits (54), Expect = 0.86 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -3 Query: 398 SIKLIKKPFSLFSRWSGFVMNTKSFSSSSKNIEMAVDL 285 +++L+KKP SL S W + N ++A+ L Sbjct: 156 TVRLLKKPPSLDSEWKSSTSTIQLIEQLDSNKQLAIAL 193 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 506 SVCTHTPDTQSTTTRAPS 453 SV H PDT+ T + PS Sbjct: 135 SVIAHNPDTKRTRVKLPS 152 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 4.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 126 EYPQHVCDRPRRSRQVNPHGLVGFQG 203 ++P HVC+R R+ +N +V G Sbjct: 350 QHPLHVCERFERASVINREEIVRKHG 375 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 6.1 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 500 CTHTPDTQSTTTRAPSVTRSAAVTS 426 CT++ D+ +TTT S + S+ T+ Sbjct: 471 CTYSSDSTTTTTTTKSASTSSHSTT 495 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.0 bits (47), Expect = 6.1 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -3 Query: 512 TVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKST-CPGES 396 TV+ T T +TTT AP+ T + A +T PG++ Sbjct: 35 TVAPTTTTVAPTTTTTVAPTTTTTVAPGQTTTTTVAPGQT 74 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 22.6 bits (46), Expect = 8.0 Identities = 8/21 (38%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +2 Query: 2 PFSKRTPLLAYGSW-FNRTKI 61 PF ++T ++ +GSW FN ++ Sbjct: 159 PFDQQTCIMKFGSWTFNGDQV 179 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 22.6 bits (46), Expect = 8.0 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +3 Query: 99 DPWDDGQEAEYPQHVCDRPRRSRQVNP 179 D WDD + E+ + D P + P Sbjct: 248 DDWDDEMDGEWEPPMIDNPEYKGEWKP 274 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 539,870 Number of Sequences: 2352 Number of extensions: 10364 Number of successful extensions: 28 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -