BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12c22 (559 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 24 1.2 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 4.8 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -2 Query: 141 DFPQFSTLCRGRQHSPAPQRSGNTAETSLKFQYV 40 + PQF L ++HS +GN + + + Q+V Sbjct: 184 ELPQFRVLGHRQRHSTIHLSTGNYSRLACEIQFV 217 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 84 VVALVSADVHDKELKIEENPRVYCGRHLANARMVLC 191 + ++ +V DK +K E+N + R L +LC Sbjct: 269 IPTVLDRNVIDKWIKTEDNESLNAARMLIRQEGLLC 304 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,065 Number of Sequences: 438 Number of extensions: 2902 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -