BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12c18 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 112 8e-27 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 25 1.5 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 3.4 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 24 3.4 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 3.4 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 112 bits (270), Expect = 8e-27 Identities = 54/111 (48%), Positives = 69/111 (62%) Frame = +3 Query: 264 DVGSSIKVDKDKFQVNLDVQHFAPEEISVKTADGYIVVXXXXXXXXXXXXYISRQFVRRY 443 D GS++ + KDKFQ+NLDVQ F+PEEISVK D ++V Y+SR FVRRY Sbjct: 3 DSGSAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRY 62 Query: 444 ALPEGAAPETVESRLSSDGVLTITAPRKVPDAVKGERKVPIAQTGPVRKEI 596 LP+G + S LSSDG+LTIT PRK + ER +PI TG K++ Sbjct: 63 MLPKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITHTGQPMKQV 113 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 25.4 bits (53), Expect = 1.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 132 RPRRLLDQHFGLALTPDDLLSVAAGPLL 215 RP R LD+H LAL D + AG L Sbjct: 114 RPERFLDEHGRLALAKDLSVPFGAGKRL 141 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 24.2 bits (50), Expect = 3.4 Identities = 14/48 (29%), Positives = 18/48 (37%) Frame = +1 Query: 472 LWNRDCHQTGYSPSLRRGRCLTPSRERERCPSHRPVPFARRSRIRVKK 615 LW ++C SP R ++P S P P RS KK Sbjct: 341 LWMKNCKSCSISPVSDRSESVSPVPSLPVRSSPEPSPVLLRSPTPAKK 388 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 24.2 bits (50), Expect = 3.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 90 MSLLPYFFDDFGSRRPRRLLDQHFGLALTPDDLL 191 +S+ P + D + RR+L Q G ALT D L+ Sbjct: 34 LSVDPANYPDAPTEGIRRILQQETGRALTVDGLI 67 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 24.2 bits (50), Expect = 3.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 90 MSLLPYFFDDFGSRRPRRLLDQHFGLALTPDDLL 191 +S+ P + D + RR+L Q G ALT D L+ Sbjct: 34 LSVDPANYPDAPTEGIRRILQQETGRALTVDGLI 67 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,138 Number of Sequences: 2352 Number of extensions: 12129 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -