BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12c14 (332 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0683 - 19431034-19431495,19431632-19431997,19432055-194323... 28 1.6 01_05_0195 - 19111983-19112477,19112646-19113950,19114053-191143... 28 2.1 06_01_0584 - 4178391-4178732,4178854-4178915,4180361-4180481,418... 27 4.9 01_06_0318 - 28434817-28435197,28435333-28435461 26 8.5 >09_04_0683 - 19431034-19431495,19431632-19431997,19432055-19432326, 19433621-19433686,19433924-19433978,19434509-19434577, 19435200-19435307,19435394-19435462,19435883-19436038, 19436089-19436229,19436514-19436568,19437103-19437233, 19437382-19437486 Length = 684 Score = 28.3 bits (60), Expect = 1.6 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 12 WLFAWXRFNEVIVCNEICFLFVYIXNKILTIISKCVLCC-CEETIDNVIV 158 WL NEV + C+ + ++ L+ +CVLC CEETID+++V Sbjct: 523 WLVLPPFHNEVALNR--CWTADRLRSRGLSHPDRCVLCDQCEETIDHLLV 570 >01_05_0195 - 19111983-19112477,19112646-19113950,19114053-19114322, 19118884-19118950,19119229-19119284,19119530-19119590, 19120181-19120297,19120570-19120682,19120774-19120848, 19121464-19122045,19122056-19122271,19122372-19122497, 19126152-19126190,19126266-19126360,19126423-19126962, 19127102-19127327,19127385-19127437,19127534-19127701, 19128353-19128707,19128785-19128876,19129891-19129993 Length = 1717 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +3 Query: 63 CFLFVYIXNKILTIISKCVLCC-CEETIDNVIV 158 C+ + ++ L+ +CVLC CEETID+++V Sbjct: 731 CWTTYRLRSRGLSHPDRCVLCDQCEETIDHLLV 763 >06_01_0584 - 4178391-4178732,4178854-4178915,4180361-4180481, 4180592-4180732,4180830-4180959,4182306-4182436, 4182528-4182601,4182680-4182741,4183135-4183209, 4184658-4184760,4184835-4184991,4185549-4185743, 4186204-4186282,4186697-4186806,4187249-4187374, 4187475-4187541,4187622-4187791,4187880-4188018, 4188361-4188522,4188672-4188772,4188852-4188994, 4189438-4189537,4190364-4190414,4191062-4191169, 4191279-4191494,4191585-4191721,4191820-4191915, 4192017-4192234,4192764-4192925,4193006-4193163, 4194221-4194379 Length = 1364 Score = 26.6 bits (56), Expect = 4.9 Identities = 16/53 (30%), Positives = 21/53 (39%) Frame = +1 Query: 160 INQDXMILTWTRWLLVLSSCRGSHFDSGSDKNLLVDLKENVTVHLEAINGTPI 318 IN D +L W ++ H D L LKE T H + GTP+ Sbjct: 367 INMDSTVLKTIEWECMIVD--EGHRLKNKDSKLFGQLKEYHTKHRVLLTGTPV 417 >01_06_0318 - 28434817-28435197,28435333-28435461 Length = 169 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/16 (68%), Positives = 14/16 (87%), Gaps = 1/16 (6%) Frame = +3 Query: 114 CVLCC-CEETIDNVIV 158 CVLC CEETID+++V Sbjct: 109 CVLCDQCEETIDHLLV 124 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,287,237 Number of Sequences: 37544 Number of extensions: 109012 Number of successful extensions: 190 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 459426840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -