BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12c10 (618 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 26 0.85 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 25 2.0 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 26.2 bits (55), Expect = 0.85 Identities = 21/83 (25%), Positives = 37/83 (44%) Frame = +1 Query: 301 MEEEFIRNQERLKPQEEKIEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYV 480 + EE ++ L ++ IEEE++K+D +R T + D V + Sbjct: 784 LREELEHSRTILAKLQKGIEEEQAKLDQVRRTVQQEEQTAQAKKDAMGAVEAEI-----A 838 Query: 481 SILSFVDKDQLEPGCSVLLNHKV 549 I + +DK+Q + + NHKV Sbjct: 839 RIQASIDKEQ-QARHDLQTNHKV 860 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 157 EPPIPTRVGKKKRKAKGPDAA 219 EPP GK+ RKA+ P+ A Sbjct: 175 EPPETPMTGKRSRKARTPEEA 195 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,373 Number of Sequences: 2352 Number of extensions: 9097 Number of successful extensions: 61 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -