BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12c10 (618 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 27 0.15 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.3 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 9.6 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 9.6 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 9.6 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 9.6 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.6 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 27.1 bits (57), Expect = 0.15 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +1 Query: 442 AIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVG 564 AIV ++GS + I +V + LE C+++ H V ++G Sbjct: 335 AIVLGAIGSIVFYIISRYVFRSALEDYCNIVATHLVCGILG 375 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 71 FPSLLNFKINTSAPIYNLLRLQS 3 FP L+ +K S P YN+ Q+ Sbjct: 198 FPPLVGWKDKRSHPAYNMTFAQN 220 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 319 RNQERLKPQEEKIEEERS 372 R E+L +EEK+ EER+ Sbjct: 17 RQYEKLCNEEEKLLEERT 34 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 319 RNQERLKPQEEKIEEERS 372 R E+L +EEK+ EER+ Sbjct: 17 RQYEKLCNEEEKLLEERT 34 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 319 RNQERLKPQEEKIEEERS 372 R E+L +EEK+ EER+ Sbjct: 17 RQYEKLCNEEEKLLEERT 34 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 319 RNQERLKPQEEKIEEERS 372 R E+L +EEK+ EER+ Sbjct: 17 RQYEKLCNEEEKLLEERT 34 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 475 YVSILSFVDKDQLEPGCSVL 534 Y I DK L+PGC+++ Sbjct: 83 YRMIQDAEDKGLLKPGCTII 102 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,789 Number of Sequences: 438 Number of extensions: 2419 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -