BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12c08 (527 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03510.1 68415.m00311 band 7 family protein contains Pfam pro... 144 3e-35 At1g13600.1 68414.m01595 bZIP transcription factor family protei... 29 2.6 At1g11710.1 68414.m01344 pentatricopeptide (PPR) repeat-containi... 28 4.5 At3g21810.1 68416.m02750 zinc finger (CCCH-type) family protein ... 27 5.9 >At2g03510.1 68415.m00311 band 7 family protein contains Pfam profile PF01145: SPFH domain / Band 7 family Length = 356 Score = 144 bits (349), Expect = 3e-35 Identities = 67/130 (51%), Positives = 92/130 (70%), Gaps = 5/130 (3%) Frame = +3 Query: 153 DQSSILAI--VILAVGVTVHFS---LHKVEEGHVGVYYRGGALLPVTSQAGFHMMIPLLT 317 D SSIL V A+ V F +H+V EGHVG Y+RGGALL + ++ GFH+ +P +T Sbjct: 22 DISSILIAFGVFAAIAALVMFPSSLVHQVPEGHVGAYWRGGALLNIITEPGFHLKLPFIT 81 Query: 318 SYKAIQTTLQTDEVKNVPCGTSGGVLIYFERIEVVNKLDPQSVLDMVRNFTAEYDRTLIF 497 +Y+ +Q TLQTD+V+++PCGT GGVLI FE+IEVVN+L V D + N+ YD T I+ Sbjct: 82 NYEPVQVTLQTDQVRDIPCGTKGGVLITFEKIEVVNRLRKDFVYDTLLNYGVNYDNTWIY 141 Query: 498 NKVHHELNQF 527 +K+HHE+NQF Sbjct: 142 DKIHHEINQF 151 >At1g13600.1 68414.m01595 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 196 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 254 PIINTNMSFFYFMKGKMNRDPYSQNHNGQN 165 P T+ S FY + G +N + YS + NGQ+ Sbjct: 35 PSSPTSCSSFYHLNGLINNNNYSSSSNGQD 64 >At1g11710.1 68414.m01344 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 657 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 Query: 12 IFSSLCLNLKINNFN*ICPYSDSMKSNLI 98 +FS+LCLNL+ +N + +S S+ + LI Sbjct: 32 LFSALCLNLRQRRWNTLHQFSSSLTNPLI 60 >At3g21810.1 68416.m02750 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 437 Score = 27.5 bits (58), Expect = 5.9 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +2 Query: 191 RGHGSFFPS*SRRRTCWCLLSGWSFITSYKSSWFSHDDTTSNIIQSHSDNF 343 RG + +R CW +LS S+ +W +D+ T N S DN+ Sbjct: 307 RGEEEKVENEKKRPPCWNMLSSKSYSEEESGAW--NDEDTINRSSSKEDNW 355 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,055,820 Number of Sequences: 28952 Number of extensions: 222623 Number of successful extensions: 462 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -