BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12c05 (357 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43242| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_30032| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) 28 2.6 SB_5207| Best HMM Match : TUDOR (HMM E-Value=3.1) 27 4.5 SB_5031| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_50978| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.8 SB_38746| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.8 SB_3052| Best HMM Match : Peptidase_S8 (HMM E-Value=0) 26 7.8 SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) 26 7.8 SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25) 26 7.8 SB_46143| Best HMM Match : zf-CCHC (HMM E-Value=0.26) 26 7.8 SB_37473| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.8 SB_11912| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26) 26 7.8 SB_2280| Best HMM Match : RVT_1 (HMM E-Value=1.4e-25) 26 7.8 >SB_43242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 43.6 bits (98), Expect = 5e-05 Identities = 22/47 (46%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +2 Query: 170 HWSVKAXXXXXXXXXXMRHLKIVRRRFRNGFKEG-KPTPPKKAVASS 307 +WS+KA MRHLK+V RRF+NGF+EG + KK VA++ Sbjct: 2 NWSMKAKRRTTTGTGRMRHLKLVYRRFQNGFQEGTQAKSQKKNVAAA 48 >SB_30032| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) Length = 819 Score = 27.9 bits (59), Expect = 2.6 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 113 CDMTIYHIFCITYGSYFGA 57 CD +IYHI+ + Y ++GA Sbjct: 355 CDSSIYHIYRLKYAVHYGA 373 >SB_5207| Best HMM Match : TUDOR (HMM E-Value=3.1) Length = 364 Score = 27.1 bits (57), Expect = 4.5 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 139 WISCSKITILPLVSEG*AQEDYWNWPHASF 228 W++C K+ +LP+ ++ Y W + F Sbjct: 136 WVNCDKVRLLPMRADEVGARVYARWTNGQF 165 >SB_5031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 27.1 bits (57), Expect = 4.5 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 139 WISCSKITILPLVSEG*AQEDYWNWPHASF 228 W++C K+ +LP+ ++ Y W + F Sbjct: 297 WVNCDKVRLLPMRADEVGARVYARWTNGQF 326 >SB_50978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 26.2 bits (55), Expect = 7.8 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 59 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 178 R NK C CG S QKS C G + + HW+ Sbjct: 217 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 257 >SB_38746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 26.2 bits (55), Expect = 7.8 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 59 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 178 R NK C CG S QKS C G + + HW+ Sbjct: 43 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 83 >SB_3052| Best HMM Match : Peptidase_S8 (HMM E-Value=0) Length = 1124 Score = 26.2 bits (55), Expect = 7.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 237 SGGASVMVLKKGNQRRPRR 293 S G+ V +L+K N+RRP++ Sbjct: 259 SNGSGVFILQKPNERRPKK 277 >SB_58648| Best HMM Match : Helicase_C (HMM E-Value=2.2e-14) Length = 679 Score = 26.2 bits (55), Expect = 7.8 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 59 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 178 R NK C CG S QKS C G + + HW+ Sbjct: 218 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 258 >SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25) Length = 1238 Score = 26.2 bits (55), Expect = 7.8 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 59 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 178 R NK C CG S QKS C G + + HW+ Sbjct: 204 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 244 >SB_46143| Best HMM Match : zf-CCHC (HMM E-Value=0.26) Length = 245 Score = 26.2 bits (55), Expect = 7.8 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 59 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 178 R NK C CG S QKS C G + + HW+ Sbjct: 204 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 244 >SB_37473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 26.2 bits (55), Expect = 7.8 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 59 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 178 R NK C CG S QKS C G + + HW+ Sbjct: 135 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 175 >SB_11912| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26) Length = 1329 Score = 26.2 bits (55), Expect = 7.8 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 59 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 178 R NK C CG S QKS C G + + HW+ Sbjct: 204 RENKQIQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 244 >SB_2280| Best HMM Match : RVT_1 (HMM E-Value=1.4e-25) Length = 1186 Score = 26.2 bits (55), Expect = 7.8 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 59 RRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKL-RSYHWS 178 R NK C CG S QKS C G + + HW+ Sbjct: 204 RENKQVQTCGNCGTSHNVTQKSLCPANGTKCSNCGKPNHWA 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,699,581 Number of Sequences: 59808 Number of extensions: 200065 Number of successful extensions: 771 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 560496285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -