BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b22 (701 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 1.8 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 1.8 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.4 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +3 Query: 108 HETIVYLPDAYPAHVAHLLADFSHRHHQVDWVLEEEQNNLTWW-RYTVRYECGAR 269 H+ + D P H + S + D+V+ +Q +W + ECG R Sbjct: 365 HDLTLIATDGEPVHPVRVNTIISFSGERYDFVINADQTPGAYWIQLRGLGECGIR 419 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +3 Query: 108 HETIVYLPDAYPAHVAHLLADFSHRHHQVDWVLEEEQNNLTWW-RYTVRYECGAR 269 H+ + D P H + S + D+V+ +Q +W + ECG R Sbjct: 365 HDLTLIATDGEPVHPVRVNTIISFSGERYDFVINADQTPGAYWIQLRGLGECGIR 419 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 2.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 274 WQRAPHSYRTVYR 236 W+R PH YR +R Sbjct: 232 WKRIPHDYRKRFR 244 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,664 Number of Sequences: 336 Number of extensions: 1531 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -