BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b22 (701 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82264-6|CAB05157.1| 214|Caenorhabditis elegans Hypothetical pr... 29 4.3 AL032626-5|CAA21525.1| 366|Caenorhabditis elegans Hypothetical ... 27 9.8 >Z82264-6|CAB05157.1| 214|Caenorhabditis elegans Hypothetical protein C49C3.12 protein. Length = 214 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +3 Query: 177 HRHHQVD--WVLEEEQNNLTWWRYTVRYECGARCQGGATVXAEADSPAR 317 H+ ++V+ W ++ N+TWW EC +GG E++S R Sbjct: 21 HKSNRVNGVWCIKVYPGNMTWWE--AERECRCTIKGGHLSGIESNSEKR 67 >AL032626-5|CAA21525.1| 366|Caenorhabditis elegans Hypothetical protein Y37D8A.5 protein. Length = 366 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 196 TGCWRRSRTT*RGGDIQCGTSAAPAARAGP 285 T W S T GG SAAPAA A P Sbjct: 38 TSSWTTSSTMAEGGQPAMDPSAAPAAAASP 67 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,418,946 Number of Sequences: 27780 Number of extensions: 144727 Number of successful extensions: 437 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 437 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -