BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b22 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19440.1 68416.m02465 pseudouridine synthase family protein l... 31 0.74 At2g05210.1 68415.m00549 expressed protein 29 3.9 At5g45060.1 68418.m05525 disease resistance protein (TIR-NBS-LRR... 27 9.1 >At3g19440.1 68416.m02465 pseudouridine synthase family protein low similarity to SP|P23851 Ribosomal large subunit pseudouridine synthase C (EC 4.2.1.70) (Pseudouridylate synthase) (Uracil hydrolyase) {Escherichia coli}; contains Pfam profile PF00849: RNA pseudouridylate synthase Length = 477 Score = 31.1 bits (67), Expect = 0.74 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 327 LVHELDRRCEPLLPLLPWPTSCEVTETVHRVRGEGAGA 440 LVH LDR C LL L T+ V ++ R + GA A Sbjct: 231 LVHRLDRDCSGLLVLARTQTAATVLHSIFREKTTGASA 268 >At2g05210.1 68415.m00549 expressed protein Length = 364 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 108 HETIVYLPDAYPAHVAHLLADFSHRHHQVDWVLEEEQNNL 227 + IV + AYP V +D + RHHQV LE+ L Sbjct: 248 YRCIVRVVAAYPWQVEDFCSDENRRHHQVLLTLEDSTATL 287 >At5g45060.1 68418.m05525 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1165 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 182 SVGEVSKKVCNVRRISIRQIDDCLVVRRAPCCV 84 S+ ++ V N++R+ + + DC V+ P CV Sbjct: 737 SISQLPDNVGNLKRLVLLNMKDCKVLETIPTCV 769 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,909,533 Number of Sequences: 28952 Number of extensions: 135356 Number of successful extensions: 363 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 363 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -