BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b21 (534 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1482 - 27428208-27428514,27428605-27428906,27431176-274322... 27 9.5 >08_02_1482 - 27428208-27428514,27428605-27428906,27431176-27432228, 27432305-27432421,27432510-27432843,27433064-27433188, 27433408-27433475,27433555-27433636,27433753-27433866, 27433942-27434042,27434145-27434234,27434615-27434819 Length = 965 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -1 Query: 381 RRKNSKAPSGDEISPATIFTVKILRRYVKKLLYR 280 RR S +P+G E++ A + ++K LRR + +LY+ Sbjct: 845 RRSFSASPAGGELNSAVVSSLKNLRR-ERDMLYK 877 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,393,535 Number of Sequences: 37544 Number of extensions: 222109 Number of successful extensions: 434 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1190246000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -