BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b19 (572 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07900.1 68416.m00965 expressed protein contains Pfam PF03138... 39 0.003 At3g17225.1 68416.m02200 invertase/pectin methylesterase inhibit... 29 1.7 At5g54960.1 68418.m06845 pyruvate decarboxylase, putative strong... 28 3.8 At5g44620.1 68418.m05467 cytochrome P450 family protein similar ... 27 8.9 >At3g07900.1 68416.m00965 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'auxin-independent growth promoter -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 579 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/81 (27%), Positives = 41/81 (50%) Frame = +2 Query: 251 QLATAQNYVASNNQYQPLISSINPNEIVKVILSRVLTSPHVHRVEVPEVKPQHNPDAKEP 430 +L TA++ + SN + + +N E+ +++ R L +P R+ +P +A +P Sbjct: 389 ELLTAKSSMTSNERKLAGLCPLNAKEVTRLL--RALGAPRDARIYWAGGEPLGGKEALKP 446 Query: 431 INTNVPHVVNNYFIVSPEYLK 493 + + PH+ N Y I P LK Sbjct: 447 LTSEFPHLYNKYDIALPLELK 467 >At3g17225.1 68416.m02200 invertase/pectin methylesterase inhibitor family protein similar to SP|P83326 Pectinesterase inhibitor (Pectin methylesterase inhibitor) (PMEI) {Actinidia chinensis}; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 185 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +2 Query: 299 PLISSINPNE-IVKVILSRVLTSPHV 373 PL SS++P++ + K LSR+ T PH+ Sbjct: 24 PLSSSLSPSDKVTKTFLSRLCTEPHI 49 >At5g54960.1 68418.m06845 pyruvate decarboxylase, putative strong similarity to pyruvate decarboxylase 1 [Vitis vinifera] GI:10732644; contains InterPro entry IPR000399: Pyruvate decarboxylase Length = 607 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 323 NEIVKVILSRVLTSPHVHRVEVPEVKP-QHNPDAKEPINTNVPHVVN 460 +E+ K I + + HR+ VPE KP + NP+ +N H+ N Sbjct: 374 SELAKRIKHNNTSYENYHRIYVPEGKPLRDNPNESLRVNVLFQHIQN 420 >At5g44620.1 68418.m05467 cytochrome P450 family protein similar to cytocrhome P450 monooxygenase (GI:14334057) [Gossypium arboreum] Length = 519 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/63 (23%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = +2 Query: 308 SSINPNEIVKVILSRVL--TSPHVHRVEVPEVKPQHNPDAKEPINTNVPHVVNNYFIVSP 481 + + N++ V++ VL T +H +E + HNPD + V VV +V Sbjct: 301 TKLTMNDVKAVLMDMVLGGTDTSLHVIEFAMAELLHNPDIMKRAQQEVDKVVGKEKVVEE 360 Query: 482 EYL 490 ++ Sbjct: 361 SHI 363 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,850,364 Number of Sequences: 28952 Number of extensions: 171919 Number of successful extensions: 412 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1112061928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -