BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b16 (622 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 131 5e-33 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 113 1e-27 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 38 6e-05 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 25 0.45 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 1.4 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 3.2 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 5.5 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 5.5 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 9.7 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 131 bits (317), Expect = 5e-33 Identities = 58/116 (50%), Positives = 82/116 (70%) Frame = +1 Query: 157 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEM 336 M + F L WNN+ +++++ F L D VDVTLA +GR L+AH++VLS CSPYF+E+ Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACDGRSLKAHRVVLSACSPYFREL 60 Query: 337 FKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGLT 504 K P +HP++ L+DV+ S L L++F+Y GEVNV Q L+SF+ TAE L+V GLT Sbjct: 61 LKSTPCKHPVIVLQDVAFSDLHALVEFIYHGEVNVHQRSLSSFLKTAEVLRVSGLT 116 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 113 bits (273), Expect = 1e-27 Identities = 52/112 (46%), Positives = 78/112 (69%), Gaps = 1/112 (0%) Frame = +1 Query: 169 EQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGRLLQAHKLVLSVCSPYFQEMFKMN 348 + + L WNN+ +NM++ FH LL VDVTLA L+AHK+VLS CS YFQ++ N Sbjct: 9 QHYCLRWNNYQSNMTSVFHQLLQTEAFVDVTLACNEASLKAHKVVLSACSSYFQKLLLSN 68 Query: 349 PTQHP-IVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGL 501 P +HP I+ +DV + L+ +++F+Y+GE++V Q EL S + TA+QL++KGL Sbjct: 69 PCKHPTIIMPQDVCFNDLKFIIEFVYRGEIDVSQAELQSLLKTADQLKIKGL 120 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 38.3 bits (85), Expect = 6e-05 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 157 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 273 M + F L WNN+ +++++ F L D VDVTLA E Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACE 39 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 25.4 bits (53), Expect = 0.45 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 406 LLQFMYQGEVNVKQEELASFIS-TAEQLQVKGLTGNQNEE 522 ++ +Y G VNV+ E + S++ ++ V GN NE+ Sbjct: 43 IIDEVYNGNVNVEDENVQSYVECMMKKFNVVDENGNFNEK 82 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 524 LSSF*LPVKPLT*SCSAVLINDANSSCLTLTSP 426 LSS P+T + S ++ N NS+C SP Sbjct: 323 LSSSTTTTSPMTSTKSTIVRNHLNSTCSVTNSP 355 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 3.2 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +1 Query: 133 VPRRVVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTL 264 V R +VA++ + F +CW FHA + S+ DV + Sbjct: 283 VIRMLVAVVVA---FFICWAPFHAQRLLAVYAQNSKDKPEDVLI 323 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 134 FHVESSLSWRRTNNFHY 184 + +S SWR TNN Y Sbjct: 211 YDFRNSRSWRITNNLFY 227 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/11 (72%), Positives = 9/11 (81%), Gaps = 1/11 (9%) Frame = -3 Query: 587 CLCCDDL-GPG 558 C CCD+L GPG Sbjct: 13 CWCCDNLGGPG 23 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = -3 Query: 176 NCSSDAMIATTRRGTYPKLCTYNS 105 NC D + +RGT + C + + Sbjct: 479 NCDIDCINRVVQRGTKMQFCIFRT 502 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,462 Number of Sequences: 438 Number of extensions: 3302 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -