BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b15 (506 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17519| Best HMM Match : HLH (HMM E-Value=6e-08) 56 2e-08 SB_15078| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32910| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_43185| Best HMM Match : HLH (HMM E-Value=4e-20) 36 0.019 SB_3962| Best HMM Match : HLH (HMM E-Value=8.8e-05) 35 0.034 SB_7678| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.077 SB_39365| Best HMM Match : HLH (HMM E-Value=5.5e-07) 34 0.077 SB_32489| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_27345| Best HMM Match : HLH (HMM E-Value=1.2e-20) 32 0.31 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 32 0.31 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 31 0.41 SB_9126| Best HMM Match : HLH (HMM E-Value=2.5e-18) 31 0.41 SB_12347| Best HMM Match : HLH (HMM E-Value=3.8e-21) 31 0.55 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.95 SB_37483| Best HMM Match : Drf_FH1 (HMM E-Value=6.6) 30 0.95 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 1.5 SB_46120| Best HMM Match : Transformer (HMM E-Value=3.2) 29 1.7 SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_984| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_27943| Best HMM Match : Pox_A32 (HMM E-Value=0.047) 29 2.2 SB_16879| Best HMM Match : Stig1 (HMM E-Value=1) 29 2.2 SB_9870| Best HMM Match : GspM (HMM E-Value=1.9) 29 2.2 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 29 2.9 SB_12345| Best HMM Match : HLH (HMM E-Value=1.4e-12) 29 2.9 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_8854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_43422| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_19020| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) 28 5.1 SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_11829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_9457| Best HMM Match : PHD (HMM E-Value=3.3e-08) 28 5.1 SB_31077| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_56420| Best HMM Match : CUB (HMM E-Value=0.45) 27 6.7 SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_34777| Best HMM Match : VWA (HMM E-Value=0) 27 6.7 SB_32053| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 27 8.9 SB_24945| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 27 8.9 SB_46206| Best HMM Match : HLH (HMM E-Value=5e-18) 27 8.9 SB_44786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_43996| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_17519| Best HMM Match : HLH (HMM E-Value=6e-08) Length = 125 Score = 56.0 bits (129), Expect = 2e-08 Identities = 31/77 (40%), Positives = 50/77 (64%) Frame = +3 Query: 90 KAITAVCATGASVPAIASGRVQRHRDGENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQH 269 +A+ A + +S+ AS + RD + + Y +L+++VP +P R+ISK+E++Q+ Sbjct: 14 EALRATIRSASSITR-ASIFSEFERDSNDNMSECY-ERLKNMVPNVPVGRRISKVEILQY 71 Query: 270 VIDYICDLQSALENHPA 320 VIDYI DLQ+ALEN A Sbjct: 72 VIDYILDLQTALENQTA 88 >SB_15078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 40.7 bits (91), Expect = 7e-04 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +3 Query: 189 MYLSKLQDLVPFMPKNRKISKLEVIQHVIDYICDLQSALENHP 317 M S+L+ LVP + ++SK++VI+ I YI LQ AL P Sbjct: 455 MEYSRLRSLVPSVASKSRVSKIQVIEEAIKYIAQLQDALRTQP 497 >SB_32910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 38.3 bits (85), Expect = 0.004 Identities = 19/64 (29%), Positives = 36/64 (56%) Frame = +3 Query: 129 PAIASGRVQRHRDGENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQHVIDYICDLQSALE 308 P+ + R +R R+ + S L+ +P+ P+ +K+SK+E ++ + YI LQS +E Sbjct: 69 PSAVARRNERERNRVRL-VNDGFSSLRQHIPYFPEKKKLSKVETLRCAVAYIKHLQSLIE 127 Query: 309 NHPA 320 + A Sbjct: 128 EYDA 131 >SB_43185| Best HMM Match : HLH (HMM E-Value=4e-20) Length = 232 Score = 35.9 bits (79), Expect = 0.019 Identities = 22/68 (32%), Positives = 35/68 (51%) Frame = +3 Query: 102 AVCATGASVPAIASGRVQRHRDGENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQHVIDY 281 AV PA+ + R R R ++ +L+ VP PKN+K+SK++ ++ I+Y Sbjct: 54 AVSTAKQKEPAVVARRNARERKRVKLVNDGFM-RLRKHVPTDPKNKKLSKVKTLRSAIEY 112 Query: 282 ICDLQSAL 305 I LQ L Sbjct: 113 IRHLQHLL 120 >SB_3962| Best HMM Match : HLH (HMM E-Value=8.8e-05) Length = 149 Score = 35.1 bits (77), Expect = 0.034 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = +3 Query: 153 QRHRDGENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQHVIDYI 284 QR R AE Y KL+++VP + + +K++KL+ IQ +YI Sbjct: 87 QRDRLRSEAEQNAY-KKLREIVPALKEQKKVTKLDTIQQTCEYI 129 >SB_7678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1432 Score = 33.9 bits (74), Expect = 0.077 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +3 Query: 180 EIQMYLSKLQDLVPFMPKNRKISKLEVIQHVIDYICDLQ 296 ++Q +L+ +VP +P R I K ++QH D+ICDL+ Sbjct: 829 QMQDAFCQLRSMVPDLP--RAIGKARLLQHAADFICDLK 865 >SB_39365| Best HMM Match : HLH (HMM E-Value=5.5e-07) Length = 105 Score = 33.9 bits (74), Expect = 0.077 Identities = 20/49 (40%), Positives = 28/49 (57%) Frame = +3 Query: 150 VQRHRDGENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQHVIDYICDLQ 296 + R R E A I+ L+ L L+P NRK+SK ++Q I+YI LQ Sbjct: 41 ISRQRKREYA-IREALNHLNSLLPLDNPNRKLSKNMILQTAIEYIRSLQ 88 >SB_32489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1240 Score = 33.1 bits (72), Expect = 0.14 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +2 Query: 374 AAAPPSEETARPSPYAQTPSSANHPPHTNTENQTAPEKT 490 A PPS+ T +P AQT + AN PP TE T P +T Sbjct: 801 ANTPPSQTTEAYTPPAQT-TEANTPPAQTTEANTPPVQT 838 Score = 31.5 bits (68), Expect = 0.41 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +2 Query: 374 AAAPPSEETARPSPYAQTPSSANHPPHTNTENQTAPEKT 490 A PP++ T +P AQT + AN PP TE+ P +T Sbjct: 811 AYTPPAQTTEANTPPAQT-TEANTPPVQTTESYNTPTET 848 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 32.3 bits (70), Expect = 0.24 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 383 PPSEETARPSPYAQTPSSANHPPHTNTENQTAPEK 487 PP EE + P P ++P S+ HPP + + +AP + Sbjct: 725 PPPEEVSLPPP-DESPPSSKHPPTVSPSSSSAPPR 758 >SB_27345| Best HMM Match : HLH (HMM E-Value=1.2e-20) Length = 153 Score = 31.9 bits (69), Expect = 0.31 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +3 Query: 204 LQDLVPFMPKNRKISKLEVIQHVIDYICDLQSALEN 311 L+ +P P N+K+SK+E ++ I+YI LQ L + Sbjct: 94 LRKHIPTTPVNKKLSKVETLRTAIEYIKHLQRILND 129 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 31.9 bits (69), Expect = 0.31 Identities = 17/52 (32%), Positives = 21/52 (40%) Frame = +2 Query: 341 RRLSVATLRSVAAAPPSEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKP 496 R + AT + PP +T P TP S N PP T P T+P Sbjct: 13 RPVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQP 64 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 31.5 bits (68), Expect = 0.41 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +2 Query: 383 PPSEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKP 496 PP ET P P ++ P + P +APE KP Sbjct: 165 PPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 >SB_9126| Best HMM Match : HLH (HMM E-Value=2.5e-18) Length = 179 Score = 31.5 bits (68), Expect = 0.41 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +3 Query: 138 ASGRVQRHRDGENAEIQMYLSKLQDLVPFMPKN-RKISKLEVIQHVIDYICDLQSALEN 311 AS R ++ R N +++ K VP + +N +K+SK+EV++ IDYI L L N Sbjct: 43 ASARERKRRHVLNNALELLRKK----VPCVDQNPQKLSKIEVLRLAIDYIAMLSCYLNN 97 >SB_12347| Best HMM Match : HLH (HMM E-Value=3.8e-21) Length = 143 Score = 31.1 bits (67), Expect = 0.55 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +3 Query: 114 TGASVPAIASGRVQRHRDGENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQHVIDYICDL 293 TG S A+ +R+R + + L+ L+P P +RK+SK+E ++ YI L Sbjct: 46 TGLSKQRQAANARERNR---THSVNAAFNALRLLIPTEPSDRKLSKIETLRLASSYIAHL 102 Query: 294 QSAL 305 + L Sbjct: 103 STIL 106 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 30.3 bits (65), Expect = 0.95 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 383 PPSEETARPSPYAQTPSSANHPPHTNTENQTAP 481 PP+ + P+P + P +A++PP + N TAP Sbjct: 201 PPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAP 233 >SB_37483| Best HMM Match : Drf_FH1 (HMM E-Value=6.6) Length = 237 Score = 30.3 bits (65), Expect = 0.95 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +2 Query: 359 TLRSVAAAPPSEETARPS--PYAQTPSSANHPPHTNTENQTAP 481 T + P A PS PY TP+ A PHT +Q AP Sbjct: 36 TSLTAPVVPLPTPVAPPSTVPYTATPAPAQQAPHTTAASQPAP 78 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = +2 Query: 347 LSVATLRSVAAAPPSEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKPT 499 LS+ V APP + P+ +A P + PP T T P P+ Sbjct: 295 LSLMAELGVGEAPPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPS 345 >SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1906 Score = 25.8 bits (54), Expect(2) = 1.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 362 LRSVAAAPPSEETARPSPYAQTPSSANHPP 451 +R A + S+ T P PY +T S A PP Sbjct: 1205 IREPADSQTSKCTTSPQPYPETKSRAPPPP 1234 Score = 22.2 bits (45), Expect(2) = 1.5 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Frame = +2 Query: 443 HPPHTNTEN---QTAPEKTK 493 HP HT+ EN Q +PE K Sbjct: 1272 HPDHTSEENLTFQASPETNK 1291 >SB_46120| Best HMM Match : Transformer (HMM E-Value=3.2) Length = 436 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 347 LSVATLRSVAAAPPSEETARPSPYAQTPSSAN-HPPHT 457 +S+AT APP+ A P P A TP + PP T Sbjct: 6 VSMATTPIPTTAPPASIEATPEPIAATPKAVKIEPPQT 43 >SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1468 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 413 PYAQTPSSANHPPHTNTENQTAPEKTKP 496 P TP PP T E T P +TKP Sbjct: 363 PPRTTPEPTTEPPQTTPEPTTEPSRTKP 390 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 413 PYAQTPSSANHPPHTNTENQTAPEKTKP 496 P TP PP T E T P +TKP Sbjct: 1093 PPRTTPEPTTEPPRTTPEPTTEPSRTKP 1120 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 386 PSEETARPS--PYAQTPSSANHPPHTNTENQTAPEKTKP 496 P T P+ P TP P T E T P +TKP Sbjct: 1093 PPRTTPEPTTEPPRTTPEPTTEPSRTKPEPTTEPSRTKP 1131 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 413 PYAQTPSSANHPPHTNTENQTAPEKTKP 496 P TP PP T E T P +T P Sbjct: 728 PPRTTPEPTTEPPRTTPEPTTEPSRTTP 755 >SB_984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 365 RSVAAAPPSEETARPSPYAQTPSSANHPPH 454 R A PP + P PY PS N PP+ Sbjct: 201 RQGGAQPPMGQNFAPPPYTAEPSKNNGPPY 230 >SB_27943| Best HMM Match : Pox_A32 (HMM E-Value=0.047) Length = 983 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/55 (30%), Positives = 22/55 (40%) Frame = +2 Query: 335 R*RRLSVATLRSVAAAPPSEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKPT 499 R R L+ A R+ A P +E A P P A + PP T E+ T Sbjct: 829 RRRELAAAFTRTPAGGPGAERAADPHPAADGGAPPTRPPLAATARTGTKERAPAT 883 >SB_16879| Best HMM Match : Stig1 (HMM E-Value=1) Length = 232 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 365 RSVAAAPPSEETARPSPYAQTPSSANHPPH 454 R A PP + P PY PS N PP+ Sbjct: 201 RQGGAQPPMGQNFAPPPYTAEPSKNNGPPY 230 >SB_9870| Best HMM Match : GspM (HMM E-Value=1.9) Length = 522 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/55 (30%), Positives = 22/55 (40%) Frame = +2 Query: 335 R*RRLSVATLRSVAAAPPSEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKPT 499 R R L+ A R+ A P +E A P P A + PP T E+ T Sbjct: 285 RRRELAAAFTRTPAGGPGAERAADPHPAADGGAPPTRPPLAATARTGTKERAPAT 339 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = +2 Query: 359 TLRSVAAAPPSEETARPSPYAQTPSSANHP---PHTNTENQTAPEKTKP 496 T + PP+ + P+ P + P PHT + T P TKP Sbjct: 133 TTKPHTTKPPTTKPQTTKPHTTKPRTTKPPTTKPHTTKPHTTKPHTTKP 181 >SB_12345| Best HMM Match : HLH (HMM E-Value=1.4e-12) Length = 124 Score = 28.7 bits (61), Expect = 2.9 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 204 LQDLVPFMPKNRKISKLEVIQHVIDYICDLQSALENHP 317 L++L+P P+ ++ +K E+I YI L +E P Sbjct: 70 LRELIPLPPQEKEPTKTEIIWMAAKYIALLSDMVEQEP 107 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 28.3 bits (60), Expect = 3.8 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 389 SEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKP 496 S+E +RPSP+A + P T + AP K+ P Sbjct: 110 SQEQSRPSPFASQEHNQT-SPFARTMDDNAPSKSSP 144 >SB_8854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -2 Query: 217 TRSWSFERYICI-SAFSPSRC-RCTRPLAIA 131 TRSW+F+R++ I + P +C +C + A+A Sbjct: 149 TRSWNFQRHVLIHTGQKPYKCQKCPKAFALA 179 >SB_43422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = +2 Query: 350 SVATLRSVAAAPPSEETARPSPYAQTPSSANHPPHTNTENQ---TAPEKTKPT 499 ++ T PS E P+++TP+S + T T N+ T P PT Sbjct: 505 NITTSSEAPTTRPSSEKPTTRPFSETPTSTSSETPTKTFNKTPATRPSSETPT 557 >SB_19020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 365 RSVAAAPPSEETARPSPYAQTPSSANHPPHTNTENQTAPE 484 +S AA P E SP +PS A+ PP +T+ + + E Sbjct: 92 KSEAALSPRTEDENSSP-VNSPSEADSPPEQDTDEEPSSE 130 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +2 Query: 383 PPSEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKP 496 PP+ +A P P P + PP T T +T P Sbjct: 106 PPATTSAPPPPTTTAPPATTSPPTTTDSPPTTAAETLP 143 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +2 Query: 368 SVAAAPPSEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKPT 499 + +APP T P P++ + PP T E T P PT Sbjct: 108 ATTSAPPPPTTTAPPATTSPPTTTDSPPTTAAE--TLPPTDAPT 149 >SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) Length = 93 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 386 PSEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKPT*Q 505 P +RP+P +PS A HPP + N +P+ Q Sbjct: 7 PKPVASRPNP-VPSPSDAAHPPFASWRNSEEARTDRPSQQ 45 >SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1680 Score = 27.9 bits (59), Expect = 5.1 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +2 Query: 359 TLRSVAAAPPSEETARPSPYAQT---PSSANHPPHTNTENQTAPEKT 490 T + AAP +E A +P AQT P+ P HT QT + T Sbjct: 616 TQSAPTAAPATEPQATVAPLAQTVTAPAQTEAPTHTAGPPQTTEQAT 662 >SB_11829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 495 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/51 (23%), Positives = 27/51 (52%) Frame = +3 Query: 159 HRDGENAEIQMYLSKLQDLVPFMPKNRKISKLEVIQHVIDYICDLQSALEN 311 H A++ L+ L+P + K+ K++++++ I+YI L + L + Sbjct: 443 HERRRVAQLNGAYQDLRQLIPGYQCDTKLPKIKILRYAINYIAHLDNILSD 493 >SB_9457| Best HMM Match : PHD (HMM E-Value=3.3e-08) Length = 344 Score = 27.9 bits (59), Expect = 5.1 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +2 Query: 365 RSVAAAPPSEETARPSPYAQTPSSANHPPHT 457 R+ AAA PS+ RP+P +T S A PP T Sbjct: 244 RTFAAARPSQSFRRPAPSTETKSFA--PPTT 272 >SB_31077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 27.5 bits (58), Expect = 6.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 154 CTRPLAIAGTEAPVAHTAVIAFILS 80 CT + I P+ HT VI FI+S Sbjct: 5 CTTTVIITTITTPITHTTVIIFIIS 29 >SB_56420| Best HMM Match : CUB (HMM E-Value=0.45) Length = 1017 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 371 VAAAPPSEETARPSPYAQTPSSANHPPHTNTE-NQTAPEKT 490 ++ AP + +A P+P T S++ PP T + T+P+ T Sbjct: 542 ISTAPQTTASAFPTPPQTTASASPTPPQTTASVSPTSPQTT 582 >SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2408 Score = 27.5 bits (58), Expect = 6.7 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 350 SVATLR-SVAAAPPSEETARPSPYAQTPSSANHPPHTNTENQTAPE 484 SV+T V PP ++ P +TPS PP TN E + PE Sbjct: 245 SVSTASPQVIDTPPEAVSSSSQPPTETPS----PPQTNAEVSSTPE 286 >SB_34777| Best HMM Match : VWA (HMM E-Value=0) Length = 1268 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 371 VAAAPPSEETARPSPYAQT-PSSANHPPHTNTENQTAPEKTK 493 ++ A ++ P A PS N PP TE+ PEK K Sbjct: 474 LSKASTDSQSGSEQPIASIEPSKQNTPPANKTESSPQPEKEK 515 >SB_32053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 27.5 bits (58), Expect = 6.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 365 RSVAAAPPSEETARPSPYAQTPSSANHPP 451 + + A+PPS P P ++P+S PP Sbjct: 308 KPIPASPPSTGKPSPPPLGESPASNTSPP 336 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +2 Query: 386 PSEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKP 496 P ++ PSP PP T+T TAP + P Sbjct: 275 PQTKSTSPSPQPTEAKPHTPPPPTSTPPTTAPRQPSP 311 >SB_24945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 356 ATLRSVAAAPPSEETARPSPYAQTPSSAN 442 A RS A P S A+P+P AQ P + + Sbjct: 286 AAARSAAGLPSSPTLAQPAPRAQAPHAGD 314 >SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 591 Score = 27.1 bits (57), Expect = 8.9 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +3 Query: 81 LKMKAITAVCATGASVPAIASGRVQRHRDGENAEIQMYLSKLQDLVPFMPKN 236 L + T A S PA SG+ + D I++ +S +Q LV F P N Sbjct: 385 LSPEKTTEGSANQYSYPAPMSGKPECLADDSKQHIRITMSDVQPLVAFWPGN 436 >SB_46206| Best HMM Match : HLH (HMM E-Value=5e-18) Length = 400 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 195 LSKLQDLVPFMPKNRKISKLEVIQHVIDYICDLQSAL 305 L L+ +P R+++KLE+++ +YI L L Sbjct: 323 LDSLKKCIPVPQSKRRVTKLEILRIACNYIKSLSDTL 359 >SB_44786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 227 HEGYEILELREVHLYLSVFAIPV 159 H GY L EVHLY+ + PV Sbjct: 644 HPGYTCTSLSEVHLYVIIQGTPV 666 >SB_43996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1056 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 386 PSEETARPSPYAQTPSSANHPPHTNTENQTAPEKTKPT 499 PS+E + PSP PS + P + +Q +PE ++P+ Sbjct: 758 PSQEHSLPSPEHSQPSPEHSQP-SPEHSQPSPEHSQPS 794 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 362 LRSVAAAPPSEETARPSPYAQTPSSANHPP 451 + S+ A PPS P+P + TP + PP Sbjct: 350 IASLVANPPSTPAPTPAPLSSTPCAPFAPP 379 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,019,786 Number of Sequences: 59808 Number of extensions: 246071 Number of successful extensions: 1156 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1139 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -