BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b14 (498 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 39 0.003 SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) 35 0.032 SB_15785| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.032 SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) 34 0.057 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.057 SB_26027| Best HMM Match : DUF164 (HMM E-Value=0.1) 34 0.075 SB_24887| Best HMM Match : PspA_IM30 (HMM E-Value=0.19) 34 0.075 SB_32866| Best HMM Match : Occludin_ELL (HMM E-Value=0.25) 32 0.23 SB_28335| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_36315| Best HMM Match : Hom_end (HMM E-Value=4.1) 30 1.2 SB_4894| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_58530| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_52694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_24812| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_11458| Best HMM Match : GTP_CDC (HMM E-Value=2.6e-09) 29 2.1 SB_36678| Best HMM Match : Aa_trans (HMM E-Value=1.8e-07) 29 2.8 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_16472| Best HMM Match : DUF922 (HMM E-Value=2.5) 29 2.8 SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) 28 3.7 SB_47240| Best HMM Match : Pkinase_C (HMM E-Value=2.8e-06) 28 3.7 SB_4371| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0027) 28 3.7 SB_939| Best HMM Match : PH (HMM E-Value=6.9e-14) 28 4.9 SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_47114| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_31526| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 28 4.9 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_25538| Best HMM Match : Kinesin (HMM E-Value=0) 28 4.9 SB_24482| Best HMM Match : KID (HMM E-Value=0.045) 28 4.9 SB_56992| Best HMM Match : Copper-bind (HMM E-Value=0.82) 27 6.5 SB_39219| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_16056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 27 6.5 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 27 6.5 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 27 6.5 SB_54850| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 27 8.6 SB_22560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 27 8.6 SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_31348| Best HMM Match : ERM (HMM E-Value=0) 27 8.6 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_15686| Best HMM Match : DUF1168 (HMM E-Value=0.87) 27 8.6 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 38.7 bits (86), Expect = 0.003 Identities = 31/104 (29%), Positives = 51/104 (49%), Gaps = 3/104 (2%) Frame = +2 Query: 95 FQPDSDVHISYEDQQKI--NKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSE 268 +Q D YED K NK R +++ + E KQ ++ L +EE +L + + Sbjct: 1726 YQADQVDDARYEDTIKDLKNKLQRQVFLLEEKQMEFSAKQRKLERLGVELEE-ALELEKD 1784 Query: 269 KIPYLIGEIFICQN-LEITLKNLEEAKAKKIHEIHDLEEKCEEL 397 + E+ C+N LEI + EE K+ EI L+++CE+L Sbjct: 1785 ALCRCQSELANCKNELEIAKQQHEEVIKGKMREISQLKKECEDL 1828 >SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) Length = 847 Score = 35.1 bits (77), Expect = 0.032 Identities = 24/102 (23%), Positives = 52/102 (50%), Gaps = 9/102 (8%) Frame = +2 Query: 152 FARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDS---------EKIPYLIGEIFIC 304 F + + +V ++K L+ + N + LE +E+L ++ EKI L G+I Sbjct: 171 FVQKDDRVTEFKCTLEARDNRIVELENKLEDLESPNNKLHHSPQFQGEKISDLEGQIDEL 230 Query: 305 QNLEITLKNLEEAKAKKIHEIHDLEEKCEELKITNE*LESTL 430 ++L L ++ +K+ +I +LE + E+L + L++++ Sbjct: 231 ESLAAEKNRLSQSLEQKMKKIMELENRVEDLTCETQRLQNSV 272 >SB_15785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 35.1 bits (77), Expect = 0.032 Identities = 33/115 (28%), Positives = 57/115 (49%), Gaps = 7/115 (6%) Frame = +2 Query: 62 IVNMSTTAKGTFQPDSD----VHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLE 229 I NM + K F+ + V I + ++K NK L +K++ D+LKV + N+E Sbjct: 90 ITNMCSRNKAIFEDLKNKCEKVSIDKDAKEKENK--DLQSKLNTANDDLKVAKRRCGNVE 147 Query: 230 EAVEELSLADDSEKIPYLIGEIFICQNLEITLKNL---EEAKAKKIHEIHDLEEK 385 E E+ +L + E + +N ++TL +L +E KK E+ DL++K Sbjct: 148 ELKEKSTLLEREVNQQNKEIERILSEN-KVTLADLSKTQENLMKKAKELEDLQQK 201 >SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) Length = 1168 Score = 34.3 bits (75), Expect = 0.057 Identities = 23/86 (26%), Positives = 44/86 (51%), Gaps = 2/86 (2%) Frame = +2 Query: 149 KFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEK--IPYLIGEIFICQNLEIT 322 K + ++ + + L+V + DV NL+ A++ELSL DS++ I L+ + + L Sbjct: 86 KSEKAQQELHEKSERLRVTEEDVSNLQRAIQELSLHKDSKESLIQQLMKKEQEIERLTTK 145 Query: 323 LKNLEEAKAKKIHEIHDLEEKCEELK 400 K+LE+ + I L+ + L+ Sbjct: 146 CKDLEKEDKENEKCIFKLQAEIMRLR 171 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 34.3 bits (75), Expect = 0.057 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 6/86 (6%) Frame = +2 Query: 161 LNAKVDDYKDELKVKQNDVKNLEEAVEEL-----SLADDSEKIPYLIGEI-FICQNLEIT 322 +NAK D E K + +L++ + EL +L D+ E + + + + NLE Sbjct: 250 VNAKNDLLNQEKKDLVKKINDLKKRITELELIINTLKDEKEALEQDVNSMSYKISNLETK 309 Query: 323 LKNLEEAKAKKIHEIHDLEEKCEELK 400 +KNLE+ KA E +LE K +K Sbjct: 310 VKNLEKEKAFYQKESEELEAKNRRMK 335 Score = 30.3 bits (65), Expect = 0.92 Identities = 31/120 (25%), Positives = 58/120 (48%), Gaps = 11/120 (9%) Frame = +2 Query: 107 SDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDV----KNLEEAVE-----ELSLAD 259 S+V + +++QK + L ++D+Y++ L+ D+ +N+ + E L + Sbjct: 1853 SNVRLEDQNKQKDAEINSLREQLDEYRNRLEKGTGDLEIHLRNIGDKSEIYRKDALDKGN 1912 Query: 260 DSEKI--PYLIGEIFICQNLEITLKNLEEAKAKKIHEIHDLEEKCEELKITNE*LESTLV 433 EK+ L EI I +NL+ L++L A+ EI LEE +L LE+ ++ Sbjct: 1913 TIEKLRAEKLQDEIEI-ENLKAELESLRNENAENEKEISHLEEDANKLGEDKNELENKII 1971 >SB_26027| Best HMM Match : DUF164 (HMM E-Value=0.1) Length = 715 Score = 33.9 bits (74), Expect = 0.075 Identities = 24/103 (23%), Positives = 53/103 (51%) Frame = +2 Query: 122 SYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFI 301 ++ ++ +NK L A+++ K ELKVK N +++L++ +E + + +E L G Sbjct: 114 NHNNENLMNKNLLLKAELNKLKYELKVKDNKIESLQDELERME-NEKTELRVELRGAEKS 172 Query: 302 CQNLEITLKNLEEAKAKKIHEIHDLEEKCEELKITNE*LESTL 430 + + + ++E K + L++ ++L++ N L S L Sbjct: 173 TEATKGVMATMKEMLTKTDEQKLALQKYIDDLELENSELTSQL 215 >SB_24887| Best HMM Match : PspA_IM30 (HMM E-Value=0.19) Length = 320 Score = 33.9 bits (74), Expect = 0.075 Identities = 27/113 (23%), Positives = 57/113 (50%), Gaps = 16/113 (14%) Frame = +2 Query: 140 KINKFARLNAKVDDYKDELKVKQNDVK-------NLEEAVEELSLADDS---------EK 271 K + ++++D+K+E+K Q+ +K LE +E+L A++ EK Sbjct: 119 KEKQLRETESRLEDFKNEVKKLQHTIKLKDKKIDGLESRLEDLESANNKLHHSLKFKEEK 178 Query: 272 IPYLIGEIFICQNLEITLKNLEEAKAKKIHEIHDLEEKCEELKITNE*LESTL 430 I L G+I ++L L ++ +K+ +I +LE + E+L + L++++ Sbjct: 179 ISDLEGQIDELESLAAEKNRLSQSLEQKMKKIMELENRVEDLTCETQRLQNSV 231 >SB_32866| Best HMM Match : Occludin_ELL (HMM E-Value=0.25) Length = 1034 Score = 32.3 bits (70), Expect = 0.23 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 4/88 (4%) Frame = +2 Query: 149 KFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLK 328 K A + +++YK E+K+K + LEE ++ +K+ E + +E LK Sbjct: 36 KNAAQHKTIENYKTEVKIKNTKISELEEQIKNF----QQQKLKSQSHESDNAKEIE-RLK 90 Query: 329 NLEEAKAKKIHEIHDL----EEKCEELK 400 EAK K+++++ ++ EK E++K Sbjct: 91 AALEAKNKQMYDLEEIVRSSAEKMEQMK 118 >SB_28335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1051 Score = 30.7 bits (66), Expect = 0.70 Identities = 26/96 (27%), Positives = 52/96 (54%), Gaps = 4/96 (4%) Frame = +2 Query: 128 EDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQ 307 E +QK+N+ L K D + Q D +++++ EE+ A + + ++ + + Sbjct: 352 ETEQKLNE---LMEKYDFTLGDKNKLQEDFESMKKNKEEVEAA-----LQQALKDLGLFK 403 Query: 308 N-LEITLKNLEEAKAK---KIHEIHDLEEKCEELKI 403 + L+ T + L AKA K H+IH++E+K +EL++ Sbjct: 404 DELKTTCEELTSAKADSKAKQHKIHEMEKKRDELQV 439 >SB_36315| Best HMM Match : Hom_end (HMM E-Value=4.1) Length = 242 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +2 Query: 65 VNMSTTAKGTFQPDSDVHISYEDQ---QKINKFARLNAKVDDYKDELKVKQNDVKNL 226 VN+ G + D + ++YEDQ +++ KF+ NA V+ D + + ++KN+ Sbjct: 148 VNLLADLSGLHKSDVNTSVTYEDQRGLKRVVKFSGENASVNIDFDAVDTRSIELKNM 204 >SB_4894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 326 KNLEEAKAKKIHEIHDLEEKCEELKI 403 + LE K H++HD E C ELK+ Sbjct: 405 EELERKNTKLCHDLHDQREACAELKV 430 >SB_58530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 29.5 bits (63), Expect = 1.6 Identities = 23/77 (29%), Positives = 39/77 (50%) Frame = +2 Query: 170 KVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLKNLEEAKA 349 KV D+ + ++ +D + A E+L A + E++ I E++ N L ++EEAK Sbjct: 204 KVSDFNRVVALECSDEEMERLAKEKLGAALNEEQLKTRI-EVYR-DNTIAMLDDMEEAKT 261 Query: 350 KKIHEIHDLEEKCEELK 400 KI +EE E+ K Sbjct: 262 TKIPAAQTIEEVFEQTK 278 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 29.5 bits (63), Expect = 1.6 Identities = 29/108 (26%), Positives = 45/108 (41%), Gaps = 2/108 (1%) Frame = +2 Query: 83 AKGTFQPDSDVHISYEDQQKINKFA-RLNAKVDDYKDELKVKQNDVKNLEEAVEELSLAD 259 +K + D D E++++ K + K + K K+ K E+ D Sbjct: 200 SKSGSESDDDEEEEEEEEKEEKKLTQKKKGKTPEQKKTPGTKKAASKQRHPTDEKRK--D 257 Query: 260 DSEKIPYLI-GEIFICQNLEITLKNLEEAKAKKIHEIHDLEEKCEELK 400 EK+ GE+ Q E K EEA+ KK ++ L +K EELK Sbjct: 258 GQEKVEEKEKGEVEDAQTTEEEEKQKEEAERKKQEKLEKLAKKKEELK 305 >SB_52694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1450 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 128 EDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADD 262 ED++K + VDD + + + K EE V +SLADD Sbjct: 442 EDEEKNEDVELVEEDVDDTAHNITADEGEEKEEEERVISVSLADD 486 >SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +2 Query: 290 EIFICQNLEITLKNLEEAKAKKIHEIHDLEEKCEELKI 403 E F LE N E K K +IH LEE+ EEL++ Sbjct: 3 ETFFHSQLEEAKANFNEEKDKLREKIHVLEEEKEELEL 40 >SB_24812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1384 Score = 29.1 bits (62), Expect = 2.1 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 5/99 (5%) Frame = +2 Query: 110 DVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVE-----ELSLADDSEKI 274 ++H Y+ + K ++ ARL +D K+EL+ + +LE A E E +L D+++KI Sbjct: 767 NLHKIYKTEAK-DEIARLQKATNDLKEELEAQGKAKYDLEAAKEKTKKLESNLKDNNDKI 825 Query: 275 PYLIGEIFICQNLEITLKNLEEAKAKKIHEIHDLEEKCE 391 L ++ Q++ LK+ E + + +L+ K + Sbjct: 826 KELEKKL---QDVTGKLKDAESKASDEEKRALELKNKLD 861 >SB_11458| Best HMM Match : GTP_CDC (HMM E-Value=2.6e-09) Length = 337 Score = 29.1 bits (62), Expect = 2.1 Identities = 28/78 (35%), Positives = 37/78 (47%) Frame = +2 Query: 161 LNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLKNLEE 340 L+AK D K KV+ + K LEE + LSL D + + Y E+F LE N + Sbjct: 170 LHAKFDHLK---KVQAEEKKKLEEKRKMLSLIDKTHTVHY---ELFRRNKLEEMGFNDGD 223 Query: 341 AKAKKIHEIHDLEEKCEE 394 A K H L+E EE Sbjct: 224 ANNKS----HSLQETYEE 237 >SB_36678| Best HMM Match : Aa_trans (HMM E-Value=1.8e-07) Length = 956 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/24 (54%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +2 Query: 212 DVKNLEEAVEELSLADD-SEKIPY 280 D++NLE+A ++L + DD SE IPY Sbjct: 48 DLQNLEDASDDLLMVDDESELIPY 71 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 287 GEIFICQNLEITLKNLEEAKAKKIHEIHDLEEKCEELK 400 GE+F+ +E T + + +AK + EI E +C E+K Sbjct: 134 GEVFVNLTVEETQEFISKAKEQIEAEIKSNEAQCNEIK 171 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 28.7 bits (61), Expect = 2.8 Identities = 24/100 (24%), Positives = 47/100 (47%), Gaps = 2/100 (2%) Frame = +2 Query: 134 QQKINKFARLNAKVDDYKDELKVKQNDVKN--LEEAVEELSLADDSEKIPYLIGEIFICQ 307 +Q+ + L ++ D +E++ +ND +N LE + ++ S ++ L C+ Sbjct: 1279 EQRSGEIDALRQELVDKTNEVEHLRNDFENQTLELKDVQQRSSELSSRLDSLADRHSECR 1338 Query: 308 NLEITLKNLEEAKAKKIHEIHDLEEKCEELKITNE*LEST 427 NLE +KNL++ + H + + L T E ES+ Sbjct: 1339 NLEFEVKNLKDQMKQLEHALESEKSSNAALIKTYEEHESS 1378 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +2 Query: 326 KNLEEAKAKKIHEIHDLEEKCEELKITNE*LESTLV 433 KNL EA+ K I E +++ + +L++ E +++TLV Sbjct: 1943 KNLHEAEQKWISESNNVRRQLSDLQVHYEKVKATLV 1978 >SB_16472| Best HMM Match : DUF922 (HMM E-Value=2.5) Length = 399 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/63 (28%), Positives = 33/63 (52%) Frame = +2 Query: 188 DELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLKNLEEAKAKKIHEI 367 D L+ Q ++ +E V EL+ + + +P+ E F L LK L+++ A + E+ Sbjct: 59 DNLEGIQFTLQEEDELVWELTSSAKKDPLPFFACETFEINGL---LKELDKSLATIVKEV 115 Query: 368 HDL 376 H+L Sbjct: 116 HEL 118 >SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) Length = 1376 Score = 28.3 bits (60), Expect = 3.7 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 5/70 (7%) Frame = +2 Query: 197 KVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQN---LEITLKNL--EEAKAKKIH 361 K++++ EE VE+L L ++S I E+ + +E T+K L EEA+ I Sbjct: 1023 KIQEDKSTIFEETVEKLPLEEESVFIKEREEELPMDDQSTVIEETIKELPLEEAETVVIK 1082 Query: 362 EIHDLEEKCE 391 + +L ++CE Sbjct: 1083 SVEELPQQCE 1092 >SB_47240| Best HMM Match : Pkinase_C (HMM E-Value=2.8e-06) Length = 619 Score = 28.3 bits (60), Expect = 3.7 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +2 Query: 104 DSDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKI 274 +S++H Y D K + + K+ D +D+L Q K LE+ E A+D ++ Sbjct: 364 ESNLHEKYRD--KAAELRKAQNKIMDLEDQLFKLQRSQKKLEKDASERRAAEDKLQV 418 >SB_4371| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0027) Length = 674 Score = 28.3 bits (60), Expect = 3.7 Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 170 KVDDYKDELKVKQNDVKNLEEAV-EELSLADDSEKI 274 +VD+ + ELK K+ + LEEA+ E +++A + E++ Sbjct: 493 RVDEIRKELKTKEERIAVLEEALTESVTIAAEREEL 528 >SB_939| Best HMM Match : PH (HMM E-Value=6.9e-14) Length = 1030 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 116 HISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEE 244 HI Q+KI++F NAKV+ K EL + + E ++E Sbjct: 129 HIKEWMQKKISEFEAQNAKVNQDKAELLERNEKLSKENELLQE 171 >SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 27.9 bits (59), Expect = 4.9 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 5/82 (6%) Frame = +2 Query: 170 KVDDYKDELKVKQNDVKNLEEAVEELS-----LADDSEKIPYLIGEIFICQNLEITLKNL 334 K+D + E++ + K+L+E + +L LA++ + L+ ++ + LE K L Sbjct: 43 KIDKLEGEIEQRATKEKDLKEKMRKLEKNNERLANEVKSKNDLLVKVAL---LETERKRL 99 Query: 335 EEAKAKKIHEIHDLEEKCEELK 400 EE K +E+KC +K Sbjct: 100 EEELKTKEKSYSKIEDKCRSMK 121 >SB_47114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 623 Score = 27.9 bits (59), Expect = 4.9 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Frame = +2 Query: 128 EDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQ 307 +D K +++ R+ ++ +D+ K K ++E E +L SEKIP + +FI + Sbjct: 21 DDVVKWSQWERVTNTIEIKQDKPKTVTKMQKTIKEGTVEEALDCLSEKIPSFLEHVFIKR 80 Query: 308 N----LEITLKNLEEAKA 349 E + NL E +A Sbjct: 81 KQSAFFEDRIANLNENEA 98 >SB_31526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1248 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +2 Query: 137 QKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLI 286 Q+I +F L AK+ YK + ++ K ++ AV + + +I YL+ Sbjct: 1195 QQITEFVGLRAKLYSYKMDEGKEEKKCKGVKRAVSRRASVSMTTRIAYLV 1244 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 27.9 bits (59), Expect = 4.9 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +2 Query: 161 LNAKVDDYKDELKVKQNDVKNLEEAVEE 244 L AK+ Y+DEL+ ++ + NL+ +E+ Sbjct: 2012 LKAKILGYRDELEREEQAISNLQNTIED 2039 Score = 27.9 bits (59), Expect = 4.9 Identities = 25/88 (28%), Positives = 38/88 (43%) Frame = +2 Query: 170 KVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLKNLEEAKA 349 K+ DEL Q + L++ V EL D ++L T K + E ++ Sbjct: 2293 KIRALNDELYEAQQKAEKLQQTVSELQQTADEHS-----------KDLHDTRKKISELES 2341 Query: 350 KKIHEIHDLEEKCEELKITNE*LESTLV 433 + + + + E EEL T E LE TLV Sbjct: 2342 DRNNLMAENENLKEELLDTKEVLERTLV 2369 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 305 QNLEITLKNLEEAKAKKIHEIHDLEEKCEELKITNE*LESTL 430 +NLE T L E + + E+ + + EEL+ NE L L Sbjct: 3166 ENLEETSTKLSETEKLRSSEVSERDSSIEELRTNNENLRGDL 3207 >SB_25538| Best HMM Match : Kinesin (HMM E-Value=0) Length = 711 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/57 (26%), Positives = 29/57 (50%) Frame = +2 Query: 77 TTAKGTFQPDSDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEEL 247 T K Q ++ ++Y+ QK+ + N + D DE+ KQ ++ +A+EE+ Sbjct: 396 TEVKEVLQALEELAVNYD--QKLQEVDAKNKENDKLNDEITTKQVELSKTTKALEEV 450 >SB_24482| Best HMM Match : KID (HMM E-Value=0.045) Length = 1714 Score = 27.9 bits (59), Expect = 4.9 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 7/72 (9%) Frame = +2 Query: 98 QPDSDVHISYEDQQKINKFARLNAK-------VDDYKDELKVKQNDVKNLEEAVEELSLA 256 +P + ++YE++ INK +L AK +D K E V ++ +L++ + EL + Sbjct: 1190 RPHAPEPLTYEERDYINKIKKLKAKLKEKREIIDKLKHEKMVVTSERSDLQKELYELKMK 1249 Query: 257 DDSEKIPYLIGE 292 I L E Sbjct: 1250 FTDRDIANLASE 1261 >SB_56992| Best HMM Match : Copper-bind (HMM E-Value=0.82) Length = 1642 Score = 27.5 bits (58), Expect = 6.5 Identities = 18/84 (21%), Positives = 38/84 (45%) Frame = +2 Query: 128 EDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQ 307 E++ A + D +++L+ ++N + N EE +EELSL + ++G C+ Sbjct: 1144 EERNNDGNTAGITISEDIRREDLQTERNAMTN-EEKLEELSLKQSKDIKDCMVGNEETCE 1202 Query: 308 NLEITLKNLEEAKAKKIHEIHDLE 379 + + +N E + D + Sbjct: 1203 SSAV--ENFERKSCNSDGDFDDAD 1224 >SB_39219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1951 Score = 27.5 bits (58), Expect = 6.5 Identities = 25/101 (24%), Positives = 44/101 (43%) Frame = +2 Query: 80 TAKGTFQPDSDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLAD 259 +++ + D D EDQ + + L++ V D + LK + D+K +A++EL D Sbjct: 990 SSRTVYTSDGDHKADKEDQPRSETPSSLHSSVSDPAEALKQENGDLK---QALQELQ--D 1044 Query: 260 DSEKIPYLIGEIFICQNLEITLKNLEEAKAKKIHEIHDLEE 382 K + E Q EI + EA + + LE+ Sbjct: 1045 RFSKDMQEMQEKAYNQRKEIVMSTEAEAIESLLRQKSSLED 1085 >SB_16056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 179 DYKDELKVKQNDVKNLEEAVEELSLADDSE 268 D+KD + +D + EE LSLAD SE Sbjct: 95 DFKDSAYISSSDSNDDEEGSNSLSLADVSE 124 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 27.5 bits (58), Expect = 6.5 Identities = 27/103 (26%), Positives = 51/103 (49%), Gaps = 1/103 (0%) Frame = +2 Query: 128 EDQQKINK-FARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFIC 304 ++ +K+ K A NAK D+K++ N +K++E EL+ ++KI YL G I Sbjct: 1899 DENEKLRKDVAAANAKATDFKNKY---LNALKDVERLQAELTA--KNQKIFYLEGRI--- 1950 Query: 305 QNLEITLKNLEEAKAKKIHEIHDLEEKCEELKITNE*LESTLV 433 + LE L++ A I +L + E + + ++S ++ Sbjct: 1951 KALEADKNRLKQEIATMKKTISELRVQIELQRQEKDRMQSDMI 1993 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +2 Query: 86 KGTFQPD-SDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEE 232 K FQ + +D+H + N+ L+A++DD + ++ Q ++K+LEE Sbjct: 3034 KNRFQDEVNDLHGKVSQKNSENEL--LHAQLDDLRKQITGYQGNIKSLEE 3081 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 27.5 bits (58), Expect = 6.5 Identities = 25/86 (29%), Positives = 40/86 (46%) Frame = +2 Query: 134 QQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNL 313 Q+++N N K++ LK +N+ +E+ ++ L D +KI GE Sbjct: 1520 QERLNDLISQNDKLNL---ALKALENEKNEIEQELQALKNNSDKKKID---GE------- 1566 Query: 314 EITLKNLEEAKAKKIHEIHDLEEKCE 391 E +L E+ +K HDLEEK E Sbjct: 1567 EESLDRFSESISKLRQAEHDLEEKLE 1592 >SB_54850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 59 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 341 AKAKKIHEIHDLEEKCEELKITNE*LESTLVW 436 AKA K E++ + E CE + + E ES +W Sbjct: 10 AKASKKFELNAVIENCEYFRSSKEICESLTIW 41 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 27.1 bits (57), Expect = 8.6 Identities = 30/122 (24%), Positives = 59/122 (48%), Gaps = 8/122 (6%) Frame = +2 Query: 59 LIVNMSTTAKG-TFQP-----DSDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVK 220 L+ N+ T A+G T + D++ ++ + +N+ A +++ K EL+V Q + + Sbjct: 353 LVSNLDTRAEGSTIEEKIQAMDTERMVAASPGEYLNE-AHSQDEIERLKLELEVVQREKE 411 Query: 221 NLEEAVEELS--LADDSEKIPYLIGEIFICQNLEITLKNLEEAKAKKIHEIHDLEEKCEE 394 + E + + + +++ + L I + LE + + LEE K + LEEK E Sbjct: 412 QILEEKDRIREIVKEENSMVSDLTENI---RGLESSRQELEELVDKLLEVRKKLEEKVAE 468 Query: 395 LK 400 LK Sbjct: 469 LK 470 >SB_22560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 341 AKAKKIHEIHDLEEKCEELKITNE*LESTLVW 436 AKA K E++ + E CE + + E ES +W Sbjct: 259 AKASKKFELNAVIENCEYFRSSKEICESLTIW 290 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 27.1 bits (57), Expect = 8.6 Identities = 23/89 (25%), Positives = 49/89 (55%), Gaps = 1/89 (1%) Frame = +2 Query: 167 AKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIF-ICQNLEITLKNLEEA 343 ++V + +D L+ + V + EE LA + ++ L+ E+ + ++L+ + +EE+ Sbjct: 1157 SEVANLRDALEKANSKVAHSEEI-----LALKAARLKELVNELDKMKKDLDAQKQAIEES 1211 Query: 344 KAKKIHEIHDLEEKCEELKITNE*LESTL 430 ++++ I ++EEK +E K LE TL Sbjct: 1212 RSEESGIIGEMEEKLKESKDKISKLEGTL 1240 >SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1531 Score = 27.1 bits (57), Expect = 8.6 Identities = 20/80 (25%), Positives = 36/80 (45%) Frame = +2 Query: 128 EDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQ 307 E QQK + K+ + LK + ++KN E V ++ + +K + + Q Sbjct: 981 ELQQKDKSLKEKDGKLAELDQALKESRKEIKNREAQVSQMDSSMREQKTEIYQKTMALEQ 1040 Query: 308 NLEITLKNLEEAKAKKIHEI 367 NL + L E +A +I E+ Sbjct: 1041 NLNQSRHELSE-RAVEIAEL 1059 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 27.1 bits (57), Expect = 8.6 Identities = 24/86 (27%), Positives = 41/86 (47%) Frame = +2 Query: 155 ARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLKNL 334 A L + + +Y+D + + + K LEE L SEK ++ + Q E K L Sbjct: 2158 ALLESALGEYQDHIDMLERKSKELEE-----ELNTKSEKEVEMLSRVNELQ--EELAKAL 2210 Query: 335 EEAKAKKIHEIHDLEEKCEELKITNE 412 E A+A K E E++ E ++++ E Sbjct: 2211 ESAEAGKKAEKQLKEQESEHVELSRE 2236 >SB_49606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 27.1 bits (57), Expect = 8.6 Identities = 17/74 (22%), Positives = 35/74 (47%) Frame = +2 Query: 176 DDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLKNLEEAKAKK 355 ++ +E K ++ K L+ V++ + D + K E F + + L L+ + Sbjct: 200 EELAEEKKTSESLKKELDALVKKAKVIDSALKTAEADLEAFQREKQQ-KLNELDVVVVLR 258 Query: 356 IHEIHDLEEKCEEL 397 +H+I +LEEK + Sbjct: 259 LHQIDELEEKVRNM 272 >SB_31348| Best HMM Match : ERM (HMM E-Value=0) Length = 665 Score = 27.1 bits (57), Expect = 8.6 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 1/102 (0%) Frame = +2 Query: 86 KGTFQPDSDVHISY-EDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADD 262 K F P H ED+ N A + ++++ +++KN ++ +++ D Sbjct: 430 KDHFYPCHKCHNEMMEDETLWNNKADSEKQSSTDENDIDNDDSEIKNKNDSNKQMDSVDT 489 Query: 263 SEKIPYLIGEIFICQNLEITLKNLEEAKAKKIHEIHDLEEKC 388 E I I ++ + K+++ K H +L + C Sbjct: 490 MESIALASSSESIKRHGSVDSKSVDSVKCTNCHVDQELSQHC 531 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 27.1 bits (57), Expect = 8.6 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 5/85 (5%) Frame = +2 Query: 164 NAKVDDYKDELKVKQNDVKN----LEEAVEELSLADDSEKIPYLIGEIFIC-QNLEITLK 328 ++KV + EL K ++++ + E E D K L+ E+ + + E + Sbjct: 467 HSKVRVRETELSEKYHELEKQLRVISEKSENTKTEYDKSKEKELLQEMLVVVEKREQLIA 526 Query: 329 NLEEAKAKKIHEIHDLEEKCEELKI 403 ++E+K + + E DLE + EE+ I Sbjct: 527 EMDESKHRYMDEDKDLERQSEEIGI 551 >SB_15686| Best HMM Match : DUF1168 (HMM E-Value=0.87) Length = 488 Score = 27.1 bits (57), Expect = 8.6 Identities = 24/100 (24%), Positives = 46/100 (46%), Gaps = 3/100 (3%) Frame = +2 Query: 110 DVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEA--VEELSLADDSEKIPYL 283 D+H SYE + N+ L+ + + +K+E K E E L ++ EK+ + Sbjct: 153 DIHDSYEQEDDGNELTELHQRNNSHKEEENNNGTHEKVASEVHEWEILENGENEEKVEWE 212 Query: 284 IGEIFICQNLEITLKNLEEAKAKKI-HEIHDLEEKCEELK 400 G + L+ +A+ ++I +E + L+E+ LK Sbjct: 213 EGRMDKSAPLDPNRPRYTKAELQEILNERNQLKEEVFFLK 252 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,524,641 Number of Sequences: 59808 Number of extensions: 158089 Number of successful extensions: 875 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -