BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b14 (498 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08780.1 68414.m00977 prefoldin, putative similar to Swiss-Pr... 66 9e-12 At1g22060.1 68414.m02759 expressed protein 35 0.026 At3g47460.1 68416.m05161 SMC2-like condensin, putative similar t... 35 0.035 At2g18876.1 68415.m02201 expressed protein 33 0.081 At1g13220.2 68414.m01534 nuclear matrix constituent protein-rela... 32 0.19 At1g32050.1 68414.m03943 secretory carrier membrane protein (SCA... 30 0.75 At4g03620.1 68417.m00497 myosin heavy chain-related contains wea... 30 1.00 At3g58270.1 68416.m06496 meprin and TRAF homology domain-contain... 30 1.00 At3g05270.1 68416.m00575 expressed protein similar to endosome-a... 30 1.00 At2g18876.2 68415.m02202 expressed protein 30 1.00 At5g45000.1 68418.m05518 Toll-Interleukin-Resistance (TIR) domai... 29 1.3 At1g60870.1 68414.m06852 expressed protein 29 1.3 At1g02330.1 68414.m00178 expressed protein contains similarity t... 29 1.3 At5g04890.1 68418.m00513 small heat shock-like protein (RTM2) si... 29 1.7 At2g34580.1 68415.m04248 hypothetical protein 29 2.3 At1g31380.1 68414.m03841 hypothetical protein 29 2.3 At5g53220.1 68418.m06616 expressed protein ; expression support... 28 3.0 At2g28360.1 68415.m03447 SIT4 phosphatase-associated family prot... 28 3.0 At4g11200.1 68417.m01813 hypothetical protein contains weak hit ... 28 4.0 At1g80790.1 68414.m09479 XH/XS domain-containing protein / XS zi... 27 5.3 At4g25250.1 68417.m03633 invertase/pectin methylesterase inhibit... 27 7.0 At4g11270.1 68417.m01823 transducin family protein / WD-40 repea... 27 7.0 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 27 7.0 At1g55255.1 68414.m06311 zinc finger (C3HC4-type RING finger) fa... 27 7.0 At1g29090.1 68414.m03561 peptidase C1A papain family protein con... 27 9.3 >At1g08780.1 68414.m00977 prefoldin, putative similar to Swiss-Prot:Q9NQP4 prefoldin subunit 4 (Protein C-1) [Homo sapiens] Length = 129 Score = 66.5 bits (155), Expect = 9e-12 Identities = 34/95 (35%), Positives = 60/95 (63%), Gaps = 3/95 (3%) Frame = +2 Query: 107 SDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLI 286 S++ +++EDQQ IN F+RLN +V D D++K + +NLE+A EL LAD+ E + + I Sbjct: 10 SEMEVTWEDQQNINIFSRLNNRVHDLDDDIKSAKEKCENLEDAGNELILADE-EMVRFQI 68 Query: 287 GEIFI---CQNLEITLKNLEEAKAKKIHEIHDLEE 382 GE+F ++E ++ ++EA K + ++ +E Sbjct: 69 GEVFAHVPRDDVETKIEEMKEATCKSLEKLEQEKE 103 >At1g22060.1 68414.m02759 expressed protein Length = 1999 Score = 35.1 bits (77), Expect = 0.026 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 2/75 (2%) Frame = +2 Query: 137 QKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLE 316 Q +N +L A +D K ELK+++N NL+ VEEL+ D + +L+ E F Q + Sbjct: 1257 QHMNANIKLLADLDSLKSELKIERNLRNNLDRRVEELTSELDEK---HLLLENFDLQKSQ 1313 Query: 317 ITL--KNLEEAKAKK 355 + L K + E +++K Sbjct: 1314 VELLEKMVAELESEK 1328 >At3g47460.1 68416.m05161 SMC2-like condensin, putative similar to SMC2-like condensin (TITAN3) [Arabidopsis thaliana] GI:14279543; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1171 Score = 34.7 bits (76), Expect = 0.035 Identities = 28/105 (26%), Positives = 52/105 (49%), Gaps = 8/105 (7%) Frame = +2 Query: 104 DSDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADD----SEK 271 D+ +H+ ++ KI K ++ + D + E+ + +K L +A E S+ + S+K Sbjct: 247 DNSIHVV--EEMKI-KMTGIDEQTDKTQGEISELEKQIKALTQA-REASMGGEVKALSDK 302 Query: 272 IPYLIGEIFI----CQNLEITLKNLEEAKAKKIHEIHDLEEKCEE 394 + L E+ N+E TL+ E+ K +H I DL++ EE Sbjct: 303 VDSLSNEVTRELSKLTNMEDTLQGEEKNAEKMVHNIEDLKKSVEE 347 >At2g18876.1 68415.m02201 expressed protein Length = 382 Score = 33.5 bits (73), Expect = 0.081 Identities = 28/106 (26%), Positives = 53/106 (50%), Gaps = 6/106 (5%) Frame = +2 Query: 98 QPDSDVHISYEDQQK--INKFARLNAKVDDYKDELKVKQNDVKNL--EEAVEELSLADDS 265 Q D + S DQ++ ++ ARL AKV+ + +L+ K+ ++ ++ EA +L + Sbjct: 79 QRDVEFRESANDQRQRLLSDMARLEAKVERLETQLQAKERELGSVTRTEAKNTAALKTQN 138 Query: 266 EKIPYLIGEI--FICQNLEITLKNLEEAKAKKIHEIHDLEEKCEEL 397 EK+ E + N ++ + L E K KK E L+E+ ++ Sbjct: 139 EKLQKERDEFQRMVIANQQVKTQQLHETK-KKEKEYIKLQERLNQV 183 >At1g13220.2 68414.m01534 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1128 Score = 32.3 bits (70), Expect = 0.19 Identities = 29/108 (26%), Positives = 52/108 (48%) Frame = +2 Query: 107 SDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLI 286 S+ + +Q KF R+N K D + +LK + K ++ + LSL EK L Sbjct: 421 SEEKLEKRNQAMNKKFDRVNEKEMDLEAKLKTIKEREKIIQAEEKRLSL----EKQQLLS 476 Query: 287 GEIFICQNLEITLKNLEEAKAKKIHEIHDLEEKCEELKITNE*LESTL 430 + ++LE + +E+ +A+ + +EE+C+ L+I E E L Sbjct: 477 DK----ESLEDLQQEIEKIRAEMTKKEEMIEEECKSLEIKKEEREEYL 520 >At1g32050.1 68414.m03943 secretory carrier membrane protein (SCAMP) family protein contains Pfam domain, PF04144: SCAMP family Length = 264 Score = 30.3 bits (65), Expect = 0.75 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +2 Query: 143 INKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIP 277 +N ++ K+ D++ EL+ K+ D+K EEA+ + + D + P Sbjct: 51 MNDSSQKQRKLADWEAELRKKEMDIKRREEAIAKFGVQIDDKNWP 95 >At4g03620.1 68417.m00497 myosin heavy chain-related contains weak similarity to Swiss-Prot:P24733 myosin heavy chain, striated muscle [Aequipecten irradians] Length = 342 Score = 29.9 bits (64), Expect = 1.00 Identities = 20/87 (22%), Positives = 42/87 (48%) Frame = +2 Query: 152 FARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLKN 331 + L D K K QND +++++ +ELS + + K ++ C +L + Sbjct: 135 YTDLKRSPDLTKSPTKPPQNDPEDIQKLRKELSASMAARKSLQMM-----CSSLGKEKEI 189 Query: 332 LEEAKAKKIHEIHDLEEKCEELKITNE 412 + ++K HE++++EE + + NE Sbjct: 190 MALELSRKAHELNEMEELVSDFRAQNE 216 >At3g58270.1 68416.m06496 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 343 Score = 29.9 bits (64), Expect = 1.00 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 6/78 (7%) Frame = +2 Query: 215 VKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLKNLEEAKAKKIHE------IHDL 376 +K + ++ +ELS D S+ L NL + LEE KK +E +H++ Sbjct: 246 IKTMCQSTQELSKDDLSDADAALAYLTDAGLNLNWLEEKLEEVSEKKENEEAGETRVHEI 305 Query: 377 EEKCEELKITNE*LESTL 430 EE+ +ELK+ LE+ L Sbjct: 306 EEELKELKLKCSNLEAQL 323 >At3g05270.1 68416.m00575 expressed protein similar to endosome-associated protein (EEA1) (GI:1016368) [Homo sapiens]; similar to smooth muscle myosin heavy chain (GI:4417214) [Homo sapiens; contains Pfam profile PF05911: Plant protein of unknown function (DUF869) Length = 615 Score = 29.9 bits (64), Expect = 1.00 Identities = 26/101 (25%), Positives = 47/101 (46%) Frame = +2 Query: 101 PDSDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPY 280 P S+ + + K + + NA V+ K ELK + LEE VE + + EK+ Sbjct: 319 PHSEPGRKHSESNK--ELEKSNAHVNQLKHELKTSLRRISELEEKVEMVEV----EKLQL 372 Query: 281 LIGEIFICQNLEITLKNLEEAKAKKIHEIHDLEEKCEELKI 403 + + +E L+E + K+ E+ LE + +EL++ Sbjct: 373 EMALNGSKEQIEALQSRLKEIEG-KLSEMKKLEAENQELEL 412 >At2g18876.2 68415.m02202 expressed protein Length = 284 Score = 29.9 bits (64), Expect = 1.00 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 4/85 (4%) Frame = +2 Query: 155 ARLNAKVDDYKDELKVKQNDVKNL--EEAVEELSLADDSEKIPYLIGEI--FICQNLEIT 322 ARL AKV+ + +L+ K+ ++ ++ EA +L +EK+ E + N ++ Sbjct: 2 ARLEAKVERLETQLQAKERELGSVTRTEAKNTAALKTQNEKLQKERDEFQRMVIANQQVK 61 Query: 323 LKNLEEAKAKKIHEIHDLEEKCEEL 397 + L E K KK E L+E+ ++ Sbjct: 62 TQQLHETK-KKEKEYIKLQERLNQV 85 >At5g45000.1 68418.m05518 Toll-Interleukin-Resistance (TIR) domain-containing protein domain signature TIR exists, suggestive of a disease resistance protein. Length = 371 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +2 Query: 155 ARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLA 256 A +AK++ + DE++V+ D++NL +EE +A Sbjct: 37 AMRDAKINVFTDEIEVRGRDIQNLLSRIEESRVA 70 >At1g60870.1 68414.m06852 expressed protein Length = 147 Score = 29.5 bits (63), Expect = 1.3 Identities = 28/97 (28%), Positives = 44/97 (45%) Frame = +2 Query: 131 DQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQN 310 D +I RL +VD YK ++ + LEEA E L A+ L + + Sbjct: 22 DPSRIEDLMRL-FEVDSYKAWAALESEQQQELEEAEESLREAE-------LELDRDMEWG 73 Query: 311 LEITLKNLEEAKAKKIHEIHDLEEKCEELKITNE*LE 421 +E + LEE + + E+ +LEEK E + T +E Sbjct: 74 MEEYRRTLEEMERMEAAELKELEEKAETARRTGNLME 110 >At1g02330.1 68414.m00178 expressed protein contains similarity to hepatocellular carcinoma-associated antigen 59 GI:7158847 from [Homo sapiens] Length = 279 Score = 29.5 bits (63), Expect = 1.3 Identities = 16/79 (20%), Positives = 38/79 (48%) Frame = +2 Query: 119 ISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIF 298 + Y +Q+ K R ++ ++ELK ++++ + + ++ + + + G Sbjct: 102 VKYIEQELAKKRGRNIDDAEEVENELKRVEDELYKIPDHLKVKKRSSEESSTQWTTGIAE 161 Query: 299 ICQNLEITLKNLEEAKAKK 355 + +E LKN+EE +A K Sbjct: 162 VQLPIEYKLKNIEETEAAK 180 >At5g04890.1 68418.m00513 small heat shock-like protein (RTM2) similar to 17.9 kDa heat-shock protein [Helianthus annuus] GI:11990130; contains Pfam profile PF00011: Hsp20/alpha crystallin family; supporting cDNA gi|7407072|gb|AF208051.1|AF208051; identical to cDNA small heat shock-like protein (RTM2) GI:7407072, small heat shock-like protein [Arabidopsis thaliana] GI:7407073 Length = 366 Score = 29.1 bits (62), Expect = 1.7 Identities = 25/79 (31%), Positives = 36/79 (45%) Frame = +2 Query: 185 KDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLKNLEEAKAKKIHE 364 K+E + KQ + LEE + + K E + L+ K EEA AKK+ E Sbjct: 143 KEEEEAKQMKKQLLEEKEALIRKLQEEAKAK----EEAEMRKLQEEAKAKEEAAAKKLQE 198 Query: 365 IHDLEEKCEELKITNE*LE 421 + +EK EE K+ LE Sbjct: 199 EIEAKEKLEERKLEERRLE 217 Score = 28.7 bits (61), Expect = 2.3 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 1/84 (1%) Frame = +2 Query: 155 ARLNAKVDDYKDELKVKQNDV-KNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLKN 331 A+ A++ ++E K K+ K L+E +E ++ + + E + LE +K Sbjct: 172 AKEEAEMRKLQEEAKAKEEAAAKKLQEEIEAKEKLEERKLEERRLEE----RKLE-DMKL 226 Query: 332 LEEAKAKKIHEIHDLEEKCEELKI 403 EEAK KKI E ++E E+ KI Sbjct: 227 AEEAKLKKIQERKSVDESGEKEKI 250 >At2g34580.1 68415.m04248 hypothetical protein Length = 203 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/87 (20%), Positives = 39/87 (44%) Frame = +2 Query: 149 KFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLK 328 K L + +DD + ++ L+ VEEL D+ + Y + C + ++ Sbjct: 66 KITILRSNIDDLDSKYHSYIQQLRTLKIEVEELKELDEEREKYYKVK----CSEMNEFMQ 121 Query: 329 NLEEAKAKKIHEIHDLEEKCEELKITN 409 N+E +++ +I +L + +E + N Sbjct: 122 NVERFRSENRLQIENLRNRIKESNMMN 148 >At1g31380.1 68414.m03841 hypothetical protein Length = 175 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +2 Query: 230 EAVEELSLADDSEKIPYLIGEIFICQNLEITLKNLEEAKAKKIHE-IHDLEEKCEELK 400 E + LA+ + Y+ F LE LK++ E + ++I E + D+++KC E+K Sbjct: 104 ENISNDDLANAYSTLSYVTKAGFKLDWLEKDLKDVGETRIQEIEEELKDIKQKCVEMK 161 >At5g53220.1 68418.m06616 expressed protein ; expression supported by MPSS Length = 441 Score = 28.3 bits (60), Expect = 3.0 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 116 HISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVE 241 H+ E Q++ N+F L K + + E V + + +NL+E+ E Sbjct: 28 HLETELQKRNNEFESLELKFKELESEKLVVEEESRNLKESEE 69 >At2g28360.1 68415.m03447 SIT4 phosphatase-associated family protein contains Pfam profile: PF04499 SIT4 phosphatase-associated protein Length = 826 Score = 28.3 bits (60), Expect = 3.0 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 3/74 (4%) Frame = +2 Query: 128 EDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSE---KIPYLIGEIF 298 ++++ I + LN+++ ++ L+ K K L VEE DS+ K P++ EIF Sbjct: 81 DEEEIIQECKALNSRLINF---LREKTQVEKLLRYVVEEPEDDADSKRAFKFPFISCEIF 137 Query: 299 ICQNLEITLKNLEE 340 C+ +++ LK L E Sbjct: 138 TCE-IDVILKTLVE 150 >At4g11200.1 68417.m01813 hypothetical protein contains weak hit to Pfam profile PF03108: MuDR family transposase Length = 462 Score = 27.9 bits (59), Expect = 4.0 Identities = 20/72 (27%), Positives = 33/72 (45%) Frame = +2 Query: 65 VNMSTTAKGTFQPDSDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEE 244 VN S K + ++ +S +DQ N ARL+ D + V + DV E ++ Sbjct: 245 VNASKKRKSVIEAAAEEEVS-DDQ---NSDARLSESPDSELEAEIVDEEDVNVKAEEIQV 300 Query: 245 LSLADDSEKIPY 280 + + E+IPY Sbjct: 301 FDIRNYEEQIPY 312 >At1g80790.1 68414.m09479 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 634 Score = 27.5 bits (58), Expect = 5.3 Identities = 25/99 (25%), Positives = 55/99 (55%) Frame = +2 Query: 104 DSDVHISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEAVEELSLADDSEKIPYL 283 +S + ++ +Q+K + R+ VD++K + + N + LE+ ++ S +I L Sbjct: 366 NSSLQLASLEQKKTDD--RVLRLVDEHKRKKEETLNKILQLEKELD--SKQKLQMEIQEL 421 Query: 284 IGEIFICQNLEITLKNLEEAKAKKIHEIHDLEEKCEELK 400 G++ + ++ + + +++ K KK+ E +LEEKC EL+ Sbjct: 422 KGKLKVMKHEDEDDEGIKK-KMKKMKE--ELEEKCSELQ 457 >At4g25250.1 68417.m03633 invertase/pectin methylesterase inhibitor family protein similar to pectinesterase from Arabidopsis thaliana SP|Q42534, Lycopersicon esculentum SP|Q43143; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 199 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +2 Query: 305 QNLEITLKNL-EEAKAKKIHEIHDLEEKCEELKITNE*LESTL 430 +N + + NL ++AKA K HE+ L++ +E+K T + L+ + Sbjct: 82 KNATLVVSNLLQKAKAAKSHEVSILKDCVDEMKDTIDELKQAV 124 >At4g11270.1 68417.m01823 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to TGF-beta resistance-associated protein TRAG (GI:15624071) {Mus musculus}; similar to beta-transducin repeats containing protein - Homo sapiens,PID:e1284220; 3' EST no_NP:TC8031 Length = 1446 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 221 NLEEAVEELSLADDSEKIPYLIGEIFICQNLEITLK 328 N EEA+ E+S DDS +L E I + T++ Sbjct: 279 NREEAIGEISFVDDSHSSNFLFKEAMILYSSTSTIE 314 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 27.1 bits (57), Expect = 7.0 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 2/93 (2%) Frame = +2 Query: 128 EDQQKINKFARLNAKVDDYKDELKVKQNDVKNL-EEAVEELSLADDSEKIPYLIGEIFIC 304 E ++K + L+ V KDE++ K D+K EE +E S EK +G+ Sbjct: 1512 EREEKEKRIQILDKYVHQLKDEVRKKTEDLKKKDEELTKERSERKSVEK---EVGDSLTK 1568 Query: 305 QNLEITLKNLEEAKAKKIH-EIHDLEEKCEELK 400 E T + E AK ++ + L E+ E+LK Sbjct: 1569 IKKEKTKVDEELAKLERYQTALTHLSEELEKLK 1601 >At1g55255.1 68414.m06311 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 383 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/65 (23%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 59 LIVNMSTTAKGTFQPDSDVH-ISYEDQQKINKFARLNAKVDDYKDELKVKQNDVKNLEEA 235 L++++ TT D + + ++ +++ + DD K EL ++ + K LEE Sbjct: 236 LVISLETTKWEVADADKEFRWLKSAVSSSEKEYEQISRRTDDIKLELDDERREKKKLEEE 295 Query: 236 VEELS 250 + EL+ Sbjct: 296 LMELN 300 >At1g29090.1 68414.m03561 peptidase C1A papain family protein contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas]; contains Pfam profile PF00112: Papain family cysteine protease Length = 355 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 132 INKKLTSLLVSMLKLTIIRMSSK 200 IN K+TS+L ++ LTI+ M+ K Sbjct: 6 INNKMTSILFMLVSLTILSMNLK 28 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,669,509 Number of Sequences: 28952 Number of extensions: 117689 Number of successful extensions: 496 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -