BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b13 (582 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF024499-7|AAB70358.3| 733|Caenorhabditis elegans Hypothetical ... 29 2.4 Z75532-6|CAA99813.2| 330|Caenorhabditis elegans Hypothetical pr... 28 4.2 Z75530-9|CAA99797.2| 330|Caenorhabditis elegans Hypothetical pr... 28 4.2 Z68114-5|CAA92155.1| 316|Caenorhabditis elegans Hypothetical pr... 28 5.6 >AF024499-7|AAB70358.3| 733|Caenorhabditis elegans Hypothetical protein F42G2.6 protein. Length = 733 Score = 29.1 bits (62), Expect = 2.4 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +1 Query: 271 IFTVNIVAAEISSPEGALEFFLRESHQYYRAVV 369 IFT +++ +G +FLR++H+Y++ +V Sbjct: 291 IFTSQYQQTKLTMKDGTEGYFLRKNHEYFKKIV 323 >Z75532-6|CAA99813.2| 330|Caenorhabditis elegans Hypothetical protein C47E8.2 protein. Length = 330 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 334 LRESHQYYRAVVRMHLVLLFTVA 402 LRE+ Y VVRMH +LL T++ Sbjct: 224 LRENEHYSETVVRMHKMLLITLS 246 >Z75530-9|CAA99797.2| 330|Caenorhabditis elegans Hypothetical protein C47E8.2 protein. Length = 330 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 334 LRESHQYYRAVVRMHLVLLFTVA 402 LRE+ Y VVRMH +LL T++ Sbjct: 224 LRENEHYSETVVRMHKMLLITLS 246 >Z68114-5|CAA92155.1| 316|Caenorhabditis elegans Hypothetical protein F17A2.7 protein. Length = 316 Score = 27.9 bits (59), Expect = 5.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 197 YEQYFINDKFVSLFGKVIFLHIYVKYL 277 Y YF+ V + +IFL IY+KYL Sbjct: 88 YSTYFLTQTAVVISNVLIFLTIYLKYL 114 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,008,406 Number of Sequences: 27780 Number of extensions: 261520 Number of successful extensions: 548 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1215936170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -