BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b12 (404 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 24 1.8 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 5.6 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 22 7.4 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 24.2 bits (50), Expect = 1.8 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +1 Query: 163 CYLVVKLTKNGSAFPSKWSRWISRWYSRKFTAPTKIR 273 CY LT S + + + S WY R + K+R Sbjct: 312 CYFGSDLTSEASCYSLTRAAYGSLWYRRSVSIQRKLR 348 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 22.6 bits (46), Expect = 5.6 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = +1 Query: 22 PDILFLQTSFNYLCSSQFICLLTYKTI 102 P ++FL F Y+C F + Y + Sbjct: 560 PQMMFLVLLFAYMCFMMFFKWIMYSAV 586 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 22.2 bits (45), Expect = 7.4 Identities = 6/23 (26%), Positives = 13/23 (56%) Frame = +1 Query: 169 LVVKLTKNGSAFPSKWSRWISRW 237 ++ L + P+ ++ W+SRW Sbjct: 180 IMANLRDEKNELPADFNEWLSRW 202 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 286,948 Number of Sequences: 2352 Number of extensions: 4249 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32494788 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -