BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b11 (567 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal ... 180 4e-47 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 25 1.3 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 25 2.3 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 24 3.0 AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-tran... 23 5.3 AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-tran... 23 5.3 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 23 6.9 AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 23 9.2 AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical prote... 23 9.2 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 9.2 >AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal carrier protein A5 protein. Length = 211 Score = 180 bits (437), Expect = 4e-47 Identities = 82/165 (49%), Positives = 113/165 (68%), Gaps = 1/165 (0%) Frame = +2 Query: 71 IRVLTRAMSTVAKSFEASQVVPDVIPKAPAALLQVKYP-SGVEVKEGNELTPTQVKDEPS 247 + V +A + ++F +++VP +I AP +++ YP S VEV GN+LTPTQVK P Sbjct: 18 VTVRGQAANPTTEAFGRNEIVPGLIDVAPEQTIKITYPQSDVEVSLGNQLTPTQVKARPK 77 Query: 248 VKWDAEPGQYYTLAMTDPDAPSRKEPTFREWHHWLVGNIQGNEVNSGETLSQYVGSGPPE 427 + W+ EP YTL M DPDAPSR P R W HWLVGNI G +V++G+ L+ YVGSGPP+ Sbjct: 78 LCWEVEPSALYTLLMADPDAPSRSNPEMRSWKHWLVGNIPGADVDAGDVLADYVGSGPPQ 137 Query: 428 KTGLHRYVFLLYKQPSKLTFDEPRLTNTSSDKRANFKIAEFAKKY 562 TGLHRYVFL+YKQPS++ F+E L++ + + R + AEF K+Y Sbjct: 138 GTGLHRYVFLVYKQPSRIVFNETVLSSRNPN-RGKWNPAEFVKEY 181 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 25.4 bits (53), Expect = 1.3 Identities = 10/24 (41%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -1 Query: 474 DGCLYKRNTYLCRPVFSGG-PEPT 406 +GCL++R+ + R +FSG +PT Sbjct: 104 NGCLFQRDAEVMRKIFSGAITDPT 127 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 24.6 bits (51), Expect = 2.3 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 439 AQIRVPLVQTTIEAHIRRAETH*HFERQTCQFQNCRVRQEVQ 564 AQ V L+ T+ AH++ A H ER Q + R+ ++++ Sbjct: 465 AQREVDLMYNTM-AHVKDAREEKHHERCAKQSETTRIEKQLE 505 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 24.2 bits (50), Expect = 3.0 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 450 CSSCTNNHRSSHSTSRDSLTLRATNVPISKLPSSPR 557 C CT +S+ T R T R+ V PSSPR Sbjct: 20 CWDCTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPR 55 >AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-transferase 3-8 protein. Length = 225 Score = 23.4 bits (48), Expect = 5.3 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -3 Query: 430 LFRRSRAHVLGQSFAGVYLVALDVANQPVVPFAKCGFFTGR 308 L RR+R H AGV L +PV+ K F + R Sbjct: 92 LVRRARVHTALHLEAGVIFSRLSFLFEPVIYSGKSYFHSDR 132 >AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-transferase E7 protein. Length = 225 Score = 23.4 bits (48), Expect = 5.3 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -3 Query: 430 LFRRSRAHVLGQSFAGVYLVALDVANQPVVPFAKCGFFTGR 308 L RR+R H AGV L +PV+ K F + R Sbjct: 92 LVRRARVHTALHLEAGVIFSRLSFLFEPVIYSGKSYFHSDR 132 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.0 bits (47), Expect = 6.9 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +3 Query: 357 ATSRATR*TPAKLCPSTWALDLRKRQACTDTCSSCTNNHRSSHSTSRD 500 A++RA T CP LDLR C+D C + RS SR+ Sbjct: 33 ASNRAGYCTTKAECPDQEQLDLR-AATCSDATHYCCPD-RSEQLPSRN 78 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +3 Query: 399 PSTWALDLRKRQACTDTCSSC 461 P W LD R T T S+C Sbjct: 81 PDGWRLDYRGSSITTTTTSTC 101 >AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +3 Query: 399 PSTWALDLRKRQACTDTCSSC 461 P W LD R T T S+C Sbjct: 81 PDGWRLDYRGSSITTTTTSTC 101 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 475 RWLFVQEEHVSVQACLFRRSRAH 407 RW Q+ H Q C +RS H Sbjct: 30 RWSLCQKLHFRDQVCCVQRSPPH 52 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 639,806 Number of Sequences: 2352 Number of extensions: 14103 Number of successful extensions: 35 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -