BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b11 (567 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18100.1 68414.m02244 mother of FT and TF1 protein (MFT) iden... 83 9e-17 At1g65480.1 68414.m07429 flowering locus T protein (FT) identica... 80 9e-16 At5g62040.1 68418.m07787 brother of FT and TFL1 protein (BFT) id... 78 5e-15 At2g27550.1 68415.m03338 centroradialis protein, putative (CEN) ... 75 3e-14 At4g20370.1 68417.m02973 twin sister of FT protein (TSF) / TFL1 ... 73 1e-13 At5g03840.1 68418.m00354 terminal flower 1 protein (TFL1) identi... 71 5e-13 At3g19650.1 68416.m02490 cyclin-related contains weak similarity... 33 0.13 At1g76510.2 68414.m08903 ARID/BRIGHT DNA-binding domain-containi... 28 5.0 At1g76510.1 68414.m08902 ARID/BRIGHT DNA-binding domain-containi... 28 5.0 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 27 6.6 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 27 6.6 At4g31210.1 68417.m04432 DNA topoisomerase family protein simila... 27 6.6 At4g25170.1 68417.m03624 expressed protein 27 6.6 At4g04470.1 68417.m00649 peroxisomal membrane protein 22 kDa (PM... 27 6.6 At5g19420.1 68418.m02314 zinc finger protein, putative / regulat... 27 8.7 At5g12350.1 68418.m01453 zinc finger protein, putative / regulat... 27 8.7 At5g10530.1 68418.m01219 lectin protein kinase, putative similar... 27 8.7 At4g12750.1 68417.m02002 expressed protein 27 8.7 At3g42730.1 68416.m04462 Ulp1 protease family protein contains P... 27 8.7 At1g64920.1 68414.m07359 glycosyltransferase family protein cont... 27 8.7 >At1g18100.1 68414.m02244 mother of FT and TF1 protein (MFT) identical to SP|Q9XFK7 MOTHER of FT and TF1 protein {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 173 Score = 83.4 bits (197), Expect = 9e-17 Identities = 51/149 (34%), Positives = 74/149 (49%), Gaps = 2/149 (1%) Frame = +2 Query: 125 QVVPDVIPK-APAALLQVKYPSGVEVKEGNELTPTQVKDEPSVKWDAEPGQYYTLAMTDP 301 +V+ DV+ P A + V Y + G E+ P+ + P V + YTL MTDP Sbjct: 12 RVIGDVLDMFIPTANMSV-YFGPKHITNGCEIKPSTAVNPPKVNISGHSDELYTLVMTDP 70 Query: 302 DAPSRKEPTFREWHHWLVGNIQ-GNEVNSGETLSQYVGSGPPEKTGLHRYVFLLYKQPSK 478 DAPS EP REW HW+V +I G + G+ + Y+ PP G+HRY+ +L++Q S Sbjct: 71 DAPSPSEPNMREWVHWIVVDIPGGTNPSRGKEILPYMEPRPP--VGIHRYILVLFRQNSP 128 Query: 479 LTFDEPRLTNTSSDKRANFKIAEFAKKYN 565 + L RANF FA ++ Sbjct: 129 V-----GLMVQQPPSRANFSTRMFAGHFD 152 >At1g65480.1 68414.m07429 flowering locus T protein (FT) identical to SP|Q9SXZ2 FLOWERING LOCUS T protein {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 175 Score = 80.2 bits (189), Expect = 9e-16 Identities = 56/151 (37%), Positives = 76/151 (50%), Gaps = 3/151 (1%) Frame = +2 Query: 122 SQVVPDVI-PKAPAALLQVKYPSGVEVKEGNELTPTQVKDEPSVKWDAEP-GQYYTLAMT 295 S+VV DV+ P + L+V Y EV G +L P+QV+++P V+ E +YTL M Sbjct: 12 SRVVGDVLDPFNRSITLKVTYGQR-EVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMV 70 Query: 296 DPDAPSRKEPTFREWHHWLVGNIQGNE-VNSGETLSQYVGSGPPEKTGLHRYVFLLYKQP 472 DPD PS P RE+ HWLV +I G + Y P G+HR VF+L++Q Sbjct: 71 DPDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCY--ENPSPTAGIHRVVFILFRQL 128 Query: 473 SKLTFDEPRLTNTSSDKRANFKIAEFAKKYN 565 + T P R NF EFA+ YN Sbjct: 129 GRQTVYAP-------GWRQNFNTREFAEIYN 152 >At5g62040.1 68418.m07787 brother of FT and TFL1 protein (BFT) identical to SP|Q9FIT4 BROTHER of FT and TFL1 protein {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 177 Score = 77.8 bits (183), Expect = 5e-15 Identities = 44/129 (34%), Positives = 69/129 (53%), Gaps = 3/129 (2%) Frame = +2 Query: 92 MSTVAKSFEASQVVPDVIPKA-PAALLQVKYPSGVEVKEGNELTPTQVKDEPSVKWDAEP 268 MS + +V+ DV+ P+ ++V + S V G+EL P+ + +P V+ + Sbjct: 1 MSREIEPLIVGRVIGDVLEMFNPSVTMRVTFNSNTIVSNGHELAPSLLLSKPRVEIGGQD 60 Query: 269 -GQYYTLAMTDPDAPSRKEPTFREWHHWLVGNIQG-NEVNSGETLSQYVGSGPPEKTGLH 442 ++TL M DPDAPS P RE+ HW+V +I G + + G + +Y P G+H Sbjct: 61 LRSFFTLIMMDPDAPSPSNPYMREYLHWMVTDIPGTTDASFGREIVRY--ETPKPVAGIH 118 Query: 443 RYVFLLYKQ 469 RYVF L+KQ Sbjct: 119 RYVFALFKQ 127 >At2g27550.1 68415.m03338 centroradialis protein, putative (CEN) strong similarity to SP|Q41261 CENTRORADIALIS protein {Antirrhinum majus}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 175 Score = 75.4 bits (177), Expect = 3e-14 Identities = 43/118 (36%), Positives = 67/118 (56%), Gaps = 3/118 (2%) Frame = +2 Query: 125 QVVPDVIPKAPAAL-LQVKYPSGVEVKEGNELTPTQVKDEPSVK-WDAEPGQYYTLAMTD 298 +V+ DV+ A+ + V Y S +V G+EL P+ V +P V+ + ++TL MTD Sbjct: 13 RVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSVVTYKPKVEVHGGDMRSFFTLVMTD 72 Query: 299 PDAPSRKEPTFREWHHWLVGNIQG-NEVNSGETLSQYVGSGPPEKTGLHRYVFLLYKQ 469 PD P +P RE HW+V +I G +V+ G+ + Y P G+HR+V+LL+KQ Sbjct: 73 PDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKEIIGY--EMPRPNIGIHRFVYLLFKQ 128 >At4g20370.1 68417.m02973 twin sister of FT protein (TSF) / TFL1 like protein identical to SP|Q9S7R5 TWIN SISTER of FT protein (TFL1 like protein) {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 175 Score = 72.9 bits (171), Expect = 1e-13 Identities = 54/149 (36%), Positives = 75/149 (50%), Gaps = 3/149 (2%) Frame = +2 Query: 128 VVPDVI-PKAPAALLQVKYPSGVEVKEGNELTPTQVKDEPSVKWDAEPGQ-YYTLAMTDP 301 VV DV+ P L+V Y EV G +L P+QV ++P V+ + + +YTL M DP Sbjct: 14 VVGDVLDPFTRLVSLKVTYGHR-EVTNGLDLRPSQVLNKPIVEIGGDDFRNFYTLVMVDP 72 Query: 302 DAPSRKEPTFREWHHWLVGNIQGNEVNS-GETLSQYVGSGPPEKTGLHRYVFLLYKQPSK 478 D PS P RE+ HWLV +I N+ G + Y PP +G+HR V +L++Q + Sbjct: 73 DVPSPSNPHQREYLHWLVTDIPATTGNAFGNEVVCYESPRPP--SGIHRIVLVLFRQLGR 130 Query: 479 LTFDEPRLTNTSSDKRANFKIAEFAKKYN 565 T P R F EFA+ YN Sbjct: 131 QTVYAP-------GWRQQFNTREFAEIYN 152 >At5g03840.1 68418.m00354 terminal flower 1 protein (TFL1) identical go SP|P93003 TERMINAL FLOWER 1 protein {Arabidopsis thaliana}; contains Pfam profile PF01161: Phosphatidylethanolamine-binding protein Length = 177 Score = 70.9 bits (166), Expect = 5e-13 Identities = 46/150 (30%), Positives = 76/150 (50%), Gaps = 3/150 (2%) Frame = +2 Query: 125 QVVPDVIPK-APAALLQVKYPSGVEVKEGNELTPTQVKDEPSVK-WDAEPGQYYTLAMTD 298 +VV DV+ P + V Y + +V G+EL P+ V +P V+ + ++TL M D Sbjct: 16 RVVGDVLDFFTPTTKMNVSY-NKKQVSNGHELFPSSVSSKPRVEIHGGDLRSFFTLVMID 74 Query: 299 PDAPSRKEPTFREWHHWLVGNIQG-NEVNSGETLSQYVGSGPPEKTGLHRYVFLLYKQPS 475 PD P +P +E HW+V NI G + G+ + Y P G+HR+VF+L++Q Sbjct: 75 PDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSY--ELPRPSIGIHRFVFVLFRQKQ 132 Query: 476 KLTFDEPRLTNTSSDKRANFKIAEFAKKYN 565 + R+ + R +F +FA +Y+ Sbjct: 133 R------RVIFPNIPSRDHFNTRKFAVEYD 156 >At3g19650.1 68416.m02490 cyclin-related contains weak similarity to Cylicin I (Multiple-band polypeptide I) (Swiss-Prot:P35662) [Bos taurus] Length = 302 Score = 33.1 bits (72), Expect = 0.13 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +1 Query: 280 HSGHDRP*CAVP*RTHISRMAPLAGWQHPGQR--GKLRRNFVPVRGLWTSGKDR 435 HSGH A P + + R P + QH +R GK+ R VRG W S +D+ Sbjct: 81 HSGHHETTKAAPHLSQVPRSRPYS--QHDDRRSDGKVDRRPTSVRGSWRSSRDQ 132 >At1g76510.2 68414.m08903 ARID/BRIGHT DNA-binding domain-containing protein contains Pfam profile PF01388: ARID/BRIGHT DNA binding domain Length = 434 Score = 27.9 bits (59), Expect = 5.0 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +2 Query: 296 DPDAPSRKEPTFREWHHWLVGNIQGNEVN 382 DP +P E + ++W WL+ + + EV+ Sbjct: 109 DPSSPHVPEESVKKWKTWLLSDAEAREVD 137 >At1g76510.1 68414.m08902 ARID/BRIGHT DNA-binding domain-containing protein contains Pfam profile PF01388: ARID/BRIGHT DNA binding domain Length = 434 Score = 27.9 bits (59), Expect = 5.0 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +2 Query: 296 DPDAPSRKEPTFREWHHWLVGNIQGNEVN 382 DP +P E + ++W WL+ + + EV+ Sbjct: 109 DPSSPHVPEESVKKWKTWLLSDAEAREVD 137 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 396 CPSTWALDLRKRQACTDTCSSCTNNHRSSHSTS-RDSLTLRATN 524 C W +DL + + C ++ +N H S S RD + L N Sbjct: 290 CVGVWVVDLSRTEPCMAGDTAQSNGHPEKRSCSGRDPVVLNDNN 333 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 396 CPSTWALDLRKRQACTDTCSSCTNNHRSSHSTS-RDSLTLRATN 524 C W +DL + + C ++ +N H S S RD + L N Sbjct: 290 CVGVWVVDLSRTEPCMAGDTAQSNGHPEKRSCSGRDPVVLNDNN 333 >At4g31210.1 68417.m04432 DNA topoisomerase family protein similar to DNA Topoisomerase I (SP:Q9X3X7) {Zymomonas mobilis} Length = 1280 Score = 27.5 bits (58), Expect = 6.6 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 375 SLPWMLPTSQWCHSRNVGSLRDGASGSVMA 286 S+ W +P+S W H +++ +GA ++A Sbjct: 520 SMVWEVPSSAWTHIKSIKVALNGAENLILA 549 >At4g25170.1 68417.m03624 expressed protein Length = 344 Score = 27.5 bits (58), Expect = 6.6 Identities = 21/58 (36%), Positives = 24/58 (41%), Gaps = 7/58 (12%) Frame = -1 Query: 477 FDGCLYK---RNTYLCRPVFSGG---PEPTYWDKVSPEFTS-LPWMLPTSQWCHSRNV 325 FD Y R+ Y C P GG P T P F S WM P+ CHSR + Sbjct: 139 FDASSYSQLVRDKYECYPENGGGNQSPIATGMVHQVPSFGSDSDWMEPSMHLCHSRTL 196 >At4g04470.1 68417.m00649 peroxisomal membrane protein 22 kDa (PMP22) identical to peroxisomal membrane protein [Arabidopsis thaliana] gi|3980254|emb|CAA06834 Length = 190 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 407 VGSGPPEKTGLHRYVFLLYKQP 472 +GS PP+KT L RY+ L + P Sbjct: 1 MGSSPPKKTTLQRYLSQLQQHP 22 >At5g19420.1 68418.m02314 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1124 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +3 Query: 480 SHSTSRDSLTLRATNVPISKLPSSPRSTT 566 S S + RAT+ PIS+ PS PRSTT Sbjct: 841 SASVPGSRIASRATS-PISRRPSPPRSTT 868 >At5g12350.1 68418.m01453 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1062 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +3 Query: 480 SHSTSRDSLTLRATNVPISKLPSSPRSTT 566 S S + RAT+ PIS+ PS PRSTT Sbjct: 805 SASVPGSRIVSRATS-PISRRPSPPRSTT 832 >At5g10530.1 68418.m01219 lectin protein kinase, putative similar to receptor lectin kinase 3 [Arabidopsis thaliana] gi|4100060|gb|AAD00733; contains protein kinase domain, Pfam:PF00069; contains legume lectins alpha and beta domains, Pfam:PF00138 and Pfam:PF00139 Length = 651 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 389 RRSLPRCPGCCQPASGAIREMWVLYG 312 R+S+ R G +P + + +MW LYG Sbjct: 532 RKSVDRRQGRVEPVTNLVEKMWDLYG 557 >At4g12750.1 68417.m02002 expressed protein Length = 1108 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +2 Query: 107 KSFEASQVVPDVIPKAPAALLQVKYPSGV 193 +S ++S + PD++PK P +Q++ P G+ Sbjct: 304 RSSDSSLLFPDLLPKFPPNSVQMRMPFGL 332 >At3g42730.1 68416.m04462 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1314 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 410 PRTGTKFRRSLPRCPGCCQPASGAIREMWVLYG 312 P+ F L CCQ + + EMW+++G Sbjct: 110 PKNKASFNAKLVLGLICCQLVTKKVNEMWIVFG 142 >At1g64920.1 68414.m07359 glycosyltransferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 452 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 308 PSRKEPTFREWHHWLVGNIQGNEV 379 P + +P +W HWL G QG+ V Sbjct: 231 PDKSKPLEDQWSHWLSGFGQGSVV 254 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,361,293 Number of Sequences: 28952 Number of extensions: 304906 Number of successful extensions: 904 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 899 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1092379416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -