BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b06 (454 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyce... 27 1.0 SPAC688.11 |end4|sla2|Huntingtin-interacting protein homolog|Sch... 26 2.3 SPBC3B9.05 |||helper of TIM |Schizosaccharomyces pombe|chr 2|||M... 25 4.1 SPBC2D10.09 |||3-hydroxyisobutyryl-CoA hydrolase|Schizosaccharom... 25 7.2 SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|... 24 9.5 SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyce... 24 9.5 SPAC4G9.04c |||cleavage and polyadenylation specificity factor |... 24 9.5 >SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1297 Score = 27.5 bits (58), Expect = 1.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 117 FFNDILRFHTLLKPEIAIHFFLIGQCA 197 F N +LRF+ LK ++ +HF L C+ Sbjct: 783 FTNILLRFYLCLKDDVDMHFLLNMDCS 809 >SPAC688.11 |end4|sla2|Huntingtin-interacting protein homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1092 Score = 26.2 bits (55), Expect = 2.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 238 LFSQIKHKEIDLLTIRKMFPLK*SKVIAKIFKVVKME 348 L++Q++ + +DLL+ K LK S I K KME Sbjct: 487 LYTQLRQEHLDLLSKYKQIQLKASSAQEAIDKKEKME 523 >SPBC3B9.05 |||helper of TIM |Schizosaccharomyces pombe|chr 2|||Manual Length = 116 Score = 25.4 bits (53), Expect = 4.1 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +1 Query: 310 KVIAKIFKVVKMEPIDLETKKCCPNCSQPYQFQILSTISKINLPL 444 K K F++ + +D E+ + CPNC + ++ + K P+ Sbjct: 46 KKCRKAFRIQFDQTMD-ESDEYCPNCDNHFVIDAITKVEKPKAPI 89 >SPBC2D10.09 |||3-hydroxyisobutyryl-CoA hydrolase|Schizosaccharomyces pombe|chr 2|||Manual Length = 429 Score = 24.6 bits (51), Expect = 7.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 345 HFYNFEDFSNYFRL 304 H Y+F+D NYF+L Sbjct: 387 HEYHFKDLENYFKL 400 >SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 843 Score = 24.2 bits (50), Expect = 9.5 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 392 WLQLGQHFFVSRSMGSIFTTLKILAITLDYFKGNIL 285 + QLG ++V+ S FT + I ++YF N++ Sbjct: 480 YFQLGSTYWVTLSYLCTFTCCIMTIIRINYFVDNVV 515 >SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1261 Score = 24.2 bits (50), Expect = 9.5 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -3 Query: 221 FSTNTNGRRALAD*EKV-YC 165 FST+ NG++ LAD +V YC Sbjct: 740 FSTDNNGQKILADISQVCYC 759 >SPAC4G9.04c |||cleavage and polyadenylation specificity factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 24.2 bits (50), Expect = 9.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 352 IDLETKKCCPNCSQPYQFQILSTISK 429 I+ +KC PNC P + +L +ISK Sbjct: 44 IEKHIQKCPPNCKLPALY-LLDSISK 68 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,835,662 Number of Sequences: 5004 Number of extensions: 35751 Number of successful extensions: 89 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 168258430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -