BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12b05 (487 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g37250.1 68415.m04570 adenylate kinase family protein contain... 28 2.9 At5g48730.1 68418.m06031 pentatricopeptide (PPR) repeat-containi... 27 5.1 At2g47230.1 68415.m05898 agenet domain-containing protein contai... 27 5.1 At5g13020.1 68418.m01492 emsy N terminus domain-containing prote... 27 6.7 At5g59900.1 68418.m07512 pentatricopeptide (PPR) repeat-containi... 27 8.9 At1g09190.1 68414.m01026 pentatricopeptide (PPR) repeat-containi... 27 8.9 >At2g37250.1 68415.m04570 adenylate kinase family protein contains Pfam profile: PF00406 adenylate kinase Length = 284 Score = 28.3 bits (60), Expect = 2.9 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -3 Query: 299 RSAGCVFAGAPGAS--AVSSRL*TRLGVARIRTADL 198 R+ VF G PG +SRL T LGV I T DL Sbjct: 50 RNVQWVFLGCPGVGKGTYASRLSTLLGVPHIATGDL 85 >At5g48730.1 68418.m06031 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 495 Score = 27.5 bits (58), Expect = 5.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 253 TAEAPGAPANTQPAERAFTAKTSSVT 330 T+ AP P N + AER FT + S++ Sbjct: 8 TSHAPPLPTNRRTAERTFTVRCISIS 33 >At2g47230.1 68415.m05898 agenet domain-containing protein contains Pfam PF05641: Agenet domain Length = 701 Score = 27.5 bits (58), Expect = 5.1 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +1 Query: 97 PLSSTPKPLARALFLRKCTVAALNARRTTNVHTARSAVLIRA--TPSRVQSRLLTAEAPG 270 P+ TP + + +R C+ A + T H RS L ++ T ++ +SR T E Sbjct: 290 PVIETPSNVMKTKPMRSCSGAKSMTPKRTTKHARRSLNLEKSAETLTKAESRAATGELRS 349 Query: 271 APAN 282 AN Sbjct: 350 KRAN 353 >At5g13020.1 68418.m01492 emsy N terminus domain-containing protein / ENT domain-containing protein contains Pfam profile PF03735: ENT domain Length = 397 Score = 27.1 bits (57), Expect = 6.7 Identities = 23/79 (29%), Positives = 38/79 (48%) Frame = +1 Query: 166 NARRTTNVHTARSAVLIRATPSRVQSRLLTAEAPGAPANTQPAERAFTAKTSSVTLTKYA 345 NAR T N R +VL A SRV + + T RAF A++ ++T K + Sbjct: 26 NARPTGN---GRPSVLNSAPLSRVHNEMETQIHLIEQEAYSSILRAFKAQSDAITWEKES 82 Query: 346 SVIQ*RRE*NAAELKKREI 402 + + R+E ++ + RE+ Sbjct: 83 LITELRKELRVSDEEHREL 101 >At5g59900.1 68418.m07512 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 907 Score = 26.6 bits (56), Expect = 8.9 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 79 VCSRWLPLSSTPKPLARALFLRKCTVAALNARRTTNVHTA 198 +CS+ P+SS P + FL T ++ ++ +H A Sbjct: 739 LCSKMQPVSSVPNQVTYGCFLDILTKGEVDMQKAVELHNA 778 >At1g09190.1 68414.m01026 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 999 Score = 26.6 bits (56), Expect = 8.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 38 NKKKQNGFNDIPVGCVRVGYLCLLRR 115 N+K+ + P GCV +GY +L+R Sbjct: 560 NEKRFDSMLTFPTGCVHLGYKQMLKR 585 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,956,952 Number of Sequences: 28952 Number of extensions: 188077 Number of successful extensions: 526 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 838967680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -