BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12a14 (681 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|... 33 0.029 SPBC32F12.01c ||SPBC685.10c|inositol phosphosphingolipid phospho... 26 4.4 >SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1953 Score = 33.5 bits (73), Expect = 0.029 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = -1 Query: 480 LYRV*RYRLCPQSLSQ*YALSHLINSVSIMKWVL*LTLRVCFYNPSLKK 334 L+ + RY L S YAL+ I+ + W+ LTLR+CF N L++ Sbjct: 618 LFHLMRYTLTGVRRSVVYALTKFISVQTSCSWITGLTLRLCFQNVLLEQ 666 >SPBC32F12.01c ||SPBC685.10c|inositol phosphosphingolipid phospholipase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 424 Score = 26.2 bits (55), Expect = 4.4 Identities = 17/65 (26%), Positives = 33/65 (50%) Frame = -3 Query: 454 MSTIALAVIRPVPPNKFSQHYEMGALTNTKSMFLQSIIKKNYRNIHRIANLVTMIPLILT 275 + T+ ++P+P + Y + + +T + Q + ++ RIA+L+ IPLI+ Sbjct: 292 IETVLSIKLQPIPVQETRVSYSI--IDDTLGITYQYMARERLHMRLRIAHLLISIPLIIG 349 Query: 274 VLVRI 260 V V I Sbjct: 350 VHVAI 354 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,599,036 Number of Sequences: 5004 Number of extensions: 50234 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -